Vedic_remedies_by_srath_pdf_free

Sanjay Rath [Author of Upadesa Sutra of Maharishi ` Jaimini (1997), Crux of Vedic Astrology (1998)] SAGAR PUBLICATIONS 72, Janpath, Ved Mansion New Delhi-110 001 Tel. : 3320648, 3328245 + ` ` ` E-mail: sagarpub@del3.vsnl.net.in --- ## Page 2 १६. ॐ गुरवे नम PREFACE There was a felt need to consolidate the various types of remedial measures available in Vedic astrology. The scope of remedial measures available is very vast and a system of classification has been attempted based on the predomi- nant guna (nature) of the remedy. The first chapter explains this classification and cautions the astrologer against in- dulging in black magic and ather forms of black tantricism that will only destroy his good karma.

Some people have expressed the opinion that Jyotish is not a vedanga and that the word ^ Vedic” is a misnomer. The six important parts of the Vedas are personified as its feet, face, hands, eyes, nose and ears. Chandas, vyakarana, kalpa, jyotish, siksha and nirukta represent these respectively. Harihara author of Prasna Marga adds that since Jyotish (Astrology) is the eye of the Vedas it is given the highest pedestal. Thus, there is no further doubt that Jyotish is a vedanga. Astrology is a very vast study and is practiced in dif- , ferent forms in various nations-around the globe. The term “Vedic Astrology” refers to Jyotish as studied and prac- ticed in the Indian sub-continent. It is composed of six parts namely: - . * Gola: The nature of planetary systems and spherical astronomy. . ` o Ganita: All aspect of mathematical astronomy and as- trology. - ५ Nimitta: Study of omens, gestures etc. The study of Omens and gestures is called Sakura Shastra while there are other related areas like Pallipatana (falling of the --- ## Page 3 common house lizard on different parts of the body at different times) or Swapna Shastra (Creamology). These have not been covered in this book for the present. Jataka: Birth Horoscopy. The Birth chart provides the details of Karma inherited from past birth and gives us the indications of the suffering due. eo Prasna: Horary astrology based on the time of query. - The Prasna or horary chart is an important tool for the Jyotish to determine whether the suffering is due to the karma of past birth or of the present birth. If the Prasna Chart alone shows the suffering while the Birth Chart is indicating otherwise, then infer that the suffering is ‘due to the bad karma in this birth. If both the Prasna and the Birth chart indicate the suffering, it is surely due to the bad karma of the past. The recommendation of remedial measures requires an intelligent application ` of mind on the part of the Astrologer. = Muhurtha: Determining auspicious time for initiating important activities like religious ceremonies etc. This by itself, is an important remedial measure. 1 the Birth , Chart has negative indications, then the best remedy is to start the concerned activity at a most auspicious date and time. This itself can check some of the negative in- dications in the Birth chart provided remedies are also carried out for alleviating the negative indications.

Omens and gestures is called Sakura Shastra while there are other related areas like Pallipatana (falling of the --- ## Page 3 common house lizard on different parts of the body at different times) or Swapna Shastra (Creamology). These have not been covered in this book for the present. Jataka: Birth Horoscopy. The Birth chart provides the details of Karma inherited from past birth and gives us the indications of the suffering due. eo Prasna: Horary astrology based on the time of query. - The Prasna or horary chart is an important tool for the Jyotish to determine whether the suffering is due to the karma of past birth or of the present birth. If the Prasna Chart alone shows the suffering while the Birth Chart is indicating otherwise, then infer that the suffering is ‘due to the bad karma in this birth. If both the Prasna and the Birth chart indicate the suffering, it is surely due to the bad karma of the past. The recommendation of remedial measures requires an intelligent application ` of mind on the part of the Astrologer. = Muhurtha: Determining auspicious time for initiating important activities like religious ceremonies etc. This by itself, is an important remedial measure. 1 the Birth , Chart has negative indications, then the best remedy is to start the concerned activity at a most auspicious date and time. This itself can check some of the negative in- dications in the Birth chart provided remedies are also carried out for alleviating the negative indications.

When an error or evil planetary combination is no- ticed, it causes hindrances and can even deny fructifica- tion of otherwise good combinations in the horoscope. Vedic remedies refer to all the methods of overcoming these hin- drances/ obstacles and helps in achieving the desired ob- jective. These remedies are normally found in books/ litera- ture dealing with Jataka, Prasna, Nimitta and Muhurtha Jyotisha. This book covers the important and effective rem- edies and in that sense, attempts a compendium of reme- dial measures. The first four chapters deal with the reme- dial methods and the principles involved, the fifth chapter is a Compendium of the most potent Mantra while the sixth --- ## Page 4 chapter shows the application of these remedies in the birth chart. The seventh chapter deals with Gemology. The Fre- quently Asked Questions have been listed at Appendix V.

Since it is established that Jyotish is the eye of the Vedas, than in what form should one aspiring for knowledge of “astrology worship the Almighty? तदविष्णु परम्‌ पदम्‌ सदापश्यन्ती सूर्‌ । दीविव चक्श्युत्तितम्‌। | (Rig Veda 1.22.20) The Rig-Veda explains that lord Vishnu is the ultimate goal (paramam padam). He preserves and protects all souls. Divivah refers to the Lord as the harbinger of day/ light and, in the physical aspect refers to the Sun whereas in the meh hysical aspect it refers to enlightenment. He is the soul/ life force of the eyes (Chaksyu: eyes). Jupiter will sig- nify this metaphysical aspect. Thus, the Sun and Jupiter become the two important significator for Dharma and Lord Maha Vishnu is the presiding deity of Jyotish. The detailed procedure for the spiritual development and cor- rect intuition for an astrologer has been given in Appendix ` [. The views of Maharishi Parasara can be understood in the Chapter titled Astrology & Deity. Vaastu & OTHER FLaws Similarly, the Vaastu® Flaws can lead to considerable trouble. This should also be indicated in the Birth Chart or Prasna Chart. The rectification of these flaws can be done either through the costly methods like making complete changes in the architecture or by applying simple Vaastu correctives like Yantra etc at the appropriate place. This is very exhaustive and has been kept out of the preview of this book. The general remedies for the Dasa-Bhukti or for ` the birth in Gandanta etc. has been included. Fait [t is important to understand that the real fight is be- --- ## Page 5 tween the extent of the problem and the faith of the Jyotish. , Thus for effective remedial measures the Jyotish must have unflinching faith in the Lord and should himself set an ex- ample of a pure and simple life. With these words, I wish the learned readers well and offer this book for the welfare of the world.

I am indebted to the inspiration of an elder Jyotisha who has been the Guru guiding this pen (I cannot mention his name as per his desire for anonymity). Such great souls continue to guide the spiritual direction of many ves. Once again Sri Narinder Sagar has come forward to support this - work as the mantle of Jyotish Publications of “Sagar Publi- cations” is passed on to the next generation: Sri Saurabh Sagar continues in the footprints of his illustrious elders. . Thank you one and all, especially Manpreet, Ravi, ` Narasimha, Ashok, Dinanath and all my Jyotish sisya.

B-59 Sekhar Apartments, Mayur Vihar Phase-1, New Delhi 110091 INDIA E-mail: srath@vsnl.com Vaastu Shastra is the science of Vedic Architecture. This takes into consideration various factors like direction, soil quality and other factors for Jud gin g the suitability of a habitation. Vaastu errors can be serious hindrances. --- ## Page 6 | Chapter 1 Chapter II Chapter पा Chapter IV Chapter V Chapter VI , Chapter Vii Appendix | AppendixIl Appendix III AppendixIV Appendix V Appendix VI ` Appendix VII ॐ गुरवे नम CONTENTS

Introduction Astrology & Deity Astrological Principles Mantra Shastra Compendium of Mantra Gemology

Case Studies

Yantra Awakening the Kundalini Nakshatra & Syllables Frequently asked Questions Rudraksha & Rosary Vi gnefhwaroopadesa References & Bibliography = ` Page 21 54 90 128 . .. 271 ` 292 381 391 394 . 405 410 430 ` 439 ` 450 --- ## Page 7 ॐ गुरवे नमः ` तपश INTRODUCTION

The question of life after death has been the seed for the birth of all religions. Simple philosophies ascribe a simple good and bad or black and white theory where the good souls go to God and the evil souls rot in hell. The definition of God has been limited by the human mind that fails to conceive of the end of the universe and consequently, fails to define God. Because of this natural limitation, every at- tempt to define God is bound to fail. This is well exempli- fied in the Upanishads where the nature of Brahman! (God) has been debated. These debates are in the form of ‘God is like water, but God is not water...” and the realiza- tion of the existence of this inner self has been stressed. The point is that all those great saints who have had this rev- elation or self-realization still fail to define God for the com- mon man due to the various limitations. Swami Abhedananda? and many other saints have done exten- sive research on this issue of life after death. The following facts emerge from their research: - 1. All beings are composed of three elements. These | are the Physical Body (Deha), the Conscious Mind ॥ Brahman is the Universal soul or God Almighty and should not be confused with Brahmana the Priest. ? “Life after Death’ by Swami Abhedananda (Ramakrishna Mission). - --- ## Page 8 2 Vedic Remedies in Astrology (called Mana) and an ethereal spirit (called Atma). 2. Consequently, birth or life would imply the com- ing together of these three factors of Body, Mind and Soul while perfect death will imply the separa- tion of these three elements. Physical or Medical death will imply the separation of the two elements of Mind and Soul from the Body. Similarly, Coma (Mental death) and such physical conditions where the death of the conscious Mind are seen, yet the person is medically alive occurs when the Body and Soul are separated from the Mind. Thus, three types of death occur where all three of Body, Mind and Soul are separated or either of Body or Mind is ` separated from the other two. However, there is ` another type of death where the Body and Mind ‘exist, but the Soul is temporarily or permanently replaced by another. This is Possession and has been recorded by various saints and shown in mov- ies like the Exorcist. 3. Normally, medical death occurs when the Body is ` separated from the Mind and the Soul. The Soul, which is conscious of its existence, continues to exist and to do such things, as it desires to do. This existence is in various astral planes, which for sim- plicity can be called the planes of consciousness. Having established that the conscious Soul exists with the Body and Mind from birth till physical death and that it exists with the Mind for some time after medical death, what happens thereafter has been the vexed question for which we have to fall back on the various philosophies and sacred literature. The Brahniana literature recognizes death even in heaven. Thus, heaven is also a state of astral exist- ence of the conscious Soul and perfect death occurs when the bond between the conscious Mind and the Soul is fi- nally broken. Besides, there can be many such heavens called loka for the existence of the conscious Soul. The void be- tween the final perfect death and birth was filled up by --- ## Page 9

the most logical magnificent theory of transmigration called samsara. In whichever form or manner, this theory sug- gests repeated deaths and births, till the soul tired of its continued independent existence and having satisfied or shed all its desires merges into the Universal Soul (God). This final end is called Moksha (emancipation) or Nirvana (liberation). The greatness of the samsara theory is its uni- versal applicability wherein all systems of life and exist- - ence were linked. It recognized the unity of Godhead. Thus the devas’ themselves were subject to change and were a part and parcel of the samsara. For example, Indra was an important Deva during the Vedic period. Subsequently, with the changes in the quality of timé His importance and popu- larity dwindled and in the Medieval India we find Indra as lokapala or digpala in-charge of and protecting the eastern direction like a doorkeeper. 1.2 COSMOLOGY 1.2.1 Quality of time ~ The quality of time is explained in the Manu Smriti where a day and night of the Gods equaled a year for hu- man beings. This formed the primary basis for progression where the progress of the Sun by about one degree! from its natal position. The quality of time was defined by the 60 Jovian years alternating as rising and falling quality of time. Thus in one Jovian cycle, we find Jupiter and Saturn mov- ing towards their simultaneous exaltations (rising time qual- ity) while in the next we find Jupiter and Saturn moving towards their mutual debility (falling time quality). These two cycles comprise the full life span of a human being (120 years). Such cycles add on to finally form the Yuga of 3 Deva has been loosely interpreted as God by most commentators who see this world in only two colors- Black and white or Good and Bad. Deva is, derived from the word Diva meaning light and hence, Deva can be inter- preted as the luminous ones or the guiding lights. Thus, Gurudeva means the "teacher (Guru) as the guiding light or Indradeva would mean Indra (the strongest} ds the guiding light. ५ The solar progression in 24 hours is approximately one degree in the zodiac. Rudimentary astrology uses this system of progression, which is presently popular in the west. , ~ . --- ## Page 10 4 . Vedic Remedies in Astrology which we are presently, in the Kali Yuga. The twelve signs of the zodiac were divided into three types of movable, fixed and dual signs to represent the three predominant Guna types of Rajas, Tamas and Satwa respectively. Thus, the four movable signs Aries, Cancer, Libra & Capricorn rep- resent Brahma the Creator. The four Yuga's are represented’ by the four quadrants of the Zodiac called chatuspada Gayatri. The ascendant of the natural Zodiac is Aries rep- resenting Krta Yuga, Cancer represents Treta Yuga, Libra represents Dwapara Yuga and Capricorn represents Kali Yuga. These quadrants are the four Gayatri’s which rise at 6 AM, Noon, 6PM and Midnight respectively everyday and during which, the pious Hindu is expected to recite the most Holy Gayatri Mantra®.. 1.2.2 Effect of Kali Yuga The effect of the Iron age (Kali Yuga) is very negative on the human mind as the negative traits of human nature will be on the rise. This is seen in various habits and ways that the world adapts to. The first is the reckoning of the day. While this should be done from sunrise, or at best 6 "AM should be made as 00 Hours, the effect of Kali Yuga is to reckon the day from the Kali Gayatri i.e. midnight in- stead. Another feature is the large number of bogus dooms- day predictions made by all kinds of God men that has resulted in many deaths and a lot of anxiety for the general public. There is no doom. Sri Achyuta Dasa® the direct dis- ciple of Sri Sri Chaitanya Mahaprabhu has stated in a stanza about India that “FROM 1300 AD TO 2000 AD INDIA SHALL SUFFER DASATW A OR BONDAGE. TOWARDS - THE END, THIS WILL BEGIN TO BREAK AND FROM 2000 AD SATYA SANATANA WILL BE ESTABLISHED.” Thus, when we are going to see a very glorious phase be- ginning 2000 AD, I cannot agree with those predictions about Doom. Later Sri Achyuta adds that the strength or $ ॐ तससवितुवीण्यं भर्गो देवस्य धीमहि । धियो यो नः प्रचोदयात्‌ । ९.७. 111.62.10 $ Sri Achyuta Dasa, the pride of the Tradition of Orissa and the Direct Dis- ciple of Sri Chaitanya Mahaprabhu has left such brilliant Gems in Oriya Prose and 1 hope to translate them properly for the benefit of all Jyotish. --- ## Page 11

1.2 COSMOLOGY

~ The quality of time is explained in the Manu Smriti where a day and night of the Gods equaled a year for hu- man beings. This formed the primary basis for progression where the progress of the Sun by about one degree! from its natal position. The quality of time was defined by the 60 Jovian years alternating as rising and falling quality of time. Thus in one Jovian cycle, we find Jupiter and Saturn mov- ing towards their simultaneous exaltations (rising time qual- ity) while in the next we find Jupiter and Saturn moving towards their mutual debility (falling time quality). These two cycles comprise the full life span of a human being (120 years). Such cycles add on to finally form the Yuga of 3 Deva has been loosely interpreted as God by most commentators who see this world in only two colors- Black and white or Good and Bad. Deva is, derived from the word Diva meaning light and hence, Deva can be inter- preted as the luminous ones or the guiding lights. Thus, Gurudeva means the "teacher (Guru) as the guiding light or Indradeva would mean Indra (the strongest} ds the guiding light.

Rudimentary astrology uses this system of progression, which is presently popular in the west. , ~ . --- ## Page 10 4 . Vedic Remedies in Astrology which we are presently, in the Kali Yuga. The twelve signs of the zodiac were divided into three types of movable, fixed and dual signs to represent the three predominant Guna types of Rajas, Tamas and Satwa respectively. Thus, the four movable signs Aries, Cancer, Libra & Capricorn rep- resent Brahma the Creator. The four Yuga's are represented’ by the four quadrants of the Zodiac called chatuspada Gayatri. The ascendant of the natural Zodiac is Aries rep- resenting Krta Yuga, Cancer represents Treta Yuga, Libra represents Dwapara Yuga and Capricorn represents Kali Yuga. These quadrants are the four Gayatri’s which rise at 6 AM, Noon, 6PM and Midnight respectively everyday and during which, the pious Hindu is expected to recite the most Holy Gayatri Mantra®..

The effect of the Iron age (Kali Yuga) is very negative on the human mind as the negative traits of human nature will be on the rise. This is seen in various habits and ways that the world adapts to. The first is the reckoning of the day. While this should be done from sunrise, or at best 6 "AM should be made as 00 Hours, the effect of Kali Yuga is to reckon the day from the Kali Gayatri i.e. midnight in- stead. Another feature is the large number of bogus dooms- day predictions made by all kinds of God men that has resulted in many deaths and a lot of anxiety for the general public. There is no doom. Sri Achyuta Dasa® the direct dis- ciple of Sri Sri Chaitanya Mahaprabhu has stated in a stanza about India that “FROM 1300 AD TO 2000 AD INDIA SHALL SUFFER DASATW A OR BONDAGE. TOWARDS - THE END, THIS WILL BEGIN TO BREAK AND FROM 2000 AD SATYA SANATANA WILL BE ESTABLISHED.” Thus, when we are going to see a very glorious phase be- ginning 2000 AD, I cannot agree with those predictions about Doom. Later Sri Achyuta adds that the strength or $ ॐ तससवितुवीण्यं भर्गो देवस्य धीमहि । धियो यो नः प्रचोदयात्‌ । ९.७. 111.62.10 $ Sri Achyuta Dasa, the pride of the Tradition of Orissa and the Direct Dis- ciple of Sri Chaitanya Mahaprabhu has left such brilliant Gems in Oriya Prose and 1 hope to translate them properly for the benefit of all Jyotish. --- ## Page 11

people of Baladeva (Sri Balaram, the elder brother of Sri Krishna) will do this. Now, we can only speculate here. 1.2.3 Brahma Vidya “Sankalpha” is a ritual performed by the pious Brah- min at the beginning of the prayers. The day of Brahma is called “Kalpha” from which the word “Sankalpha” is de- rived. Kalpha also means Lagna. Hence Brahma controls longevity and Maharishi Parasara has identified Brahma as the deity of Saturn the Ayush-Karaka’. In the day there is “Leela” and in the Night, the universe is withdrawn and exists as a potentiality. This Kalpha is about 4320 Million years and 360 such Brahma days make a Brahma Year. Now, Brahmas life is for 100 such years and it is believed that Brahma is in His 51st Year. The Kalpha is divided into 14 Manvantaras of which we are in the 7th called Manu Vaivasvata. Each Manvantara is for 306,720,000 years with gaps between the Manvantara’s in any Kalpha. Each Manvantara is further subdivided into 71 Mahayuga (approx) as 1000 Mahayuga make one Kalpha. Each Mahayuga is further divided into four Yuga’s called Krta (Four), Treta (Three), Dvapara (Two) and Kali (One) of lengths 4800, 3600, 2400 and 1200 years of the Gods? re- spectively. These four yuga together constitute the 7 Ayush-Longevity; Karaka-significator. Hence Ayush-Karaka refers to the significator of Longevity. $ A year of the Gods was equal to 360 earth years. Here the years of th Gods refers to the Sun as Deva is derived from Diva (Light} and the Sun is also called Divakara. THIS 15 WHERE THE ERROR CREEPS IN LE. THE IN- TERPRETATION OF THE TERM “YEAR OF THE GODS”. WHILE THIS IS GENERALLY ACCEPTED AS THE MOTION OF THE SUN IN ONE DAY, SOME HAVE EQUATED THIS TO ONE YEAR OF HUMAN LIFE. Thus, they misrepresent the periods as 4800, 3600, 2400 and 1200 human years instead. This is also the reason why I have been requesting the Software programuners to calculate the dasa-antar and other smaller periods correctly on the basis of the actual solar transit of 360 Degrees with fluctuations in one Year instead of interpolating on the figure of 365.25 days as a lot of approxi- ‘mation creeps in. Another blunder is to equate the year of the Gods blindly to 360 human years on the approximate basis of 1-Degree transit of the Sun per day when we know this to be 365.25 solar days. This is how another doubt of 360 days instead of 365.25 days per year has crept in --- ## Page 12 6 Vedic Remedies in Astrology Mahayuga of 12,000 years of the Gods or 4,320,000 earth years. This is the foundation stone of Vedic Astrology as it is perhaps, the least common multiple of the periods of revo- lution of the planets. Seventy-one Mahayuga’s form a -Manvantara (popularly called Manu} and fourteen Manvantaras constitute a day of Brahma called Kalpha. The day of Brahma is followed by an incidental dissolution called Naimittika wherein all living forms are only destroyed and after passing through the night of Brahma, creation again occurs The primary cosmic cycle is the Kalpha or day of Brahma equal to 4320 million earth years. Thus a day and “night of Brahma is 8640 million earth years. 360 such days’ make a year and Brahma’s life is said to be of 100 such years. At the end of the cycle of Brahma Prakrittika Mahapralaya occurs and everything including all matter and substance is dissolved. The cycle of Brohma is 311,040 Billion years after which another Brahma recreates the world from the - Navel of Narayana (World Spirit or Universal Soul, the infi- "nite God). The Zodiac as viewed from the earth with its 12 spokes demarcating the 12 signs represents the entire Uni- verse and is thus representing Narayana. Since the time quality cycle is for 120 years (two Jovian cycles of 60 years ` each), it can be represented by 120 degrees of the zodiac. ` Thus, there can be three portions of 120 degrees each start- . ing from zero degrees in Aries. These are the three navels . of the zodiac at zero, 120 and 240 degrees respectively called Brahma Nabhi. The zodiac also represents the hu- man being (Nara). Hence, Nara is said to be a replica of Narayana ` 1.2.4 Smaller cycles of time The dating of the Kali Yuga is the vexed question. Tra- dition accepts this as 3102 BC, whereas others relying on the other factors give 900 BC or 600 BC etc. How do we resolve this? Not going into other considerations, the 60- ‘the solar diurnal motion of one degree per day approx. Which was equated to a year. ॥1 --- ## Page 13

“Sankalpha” is a ritual performed by the pious Brah- min at the beginning of the prayers. The day of Brahma is called “Kalpha” from which the word “Sankalpha” is de- rived. Kalpha also means Lagna. Hence Brahma controls longevity and Maharishi Parasara has identified Brahma as the deity of Saturn the Ayush-Karaka’. In the day there is “Leela” and in the Night, the universe is withdrawn and exists as a potentiality. This Kalpha is about 4320 Million years and 360 such Brahma days make a Brahma Year. Now, Brahmas life is for 100 such years and it is believed that Brahma is in His 51st Year. The Kalpha is divided into 14 Manvantaras of which we are in the 7th called Manu Vaivasvata. Each Manvantara is for 306,720,000 years with gaps between the Manvantara’s in any Kalpha. Each Manvantara is further subdivided into 71 Mahayuga (approx) as 1000 Mahayuga make one Kalpha. Each Mahayuga is further divided into four Yuga’s called Krta (Four), Treta (Three), Dvapara (Two) and Kali (One) of lengths 4800, 3600, 2400 and 1200 years of the Gods? re- spectively. These four yuga together constitute the 7 Ayush-Longevity; Karaka-significator. Hence Ayush-Karaka refers to the significator of Longevity. $ A year of the Gods was equal to 360 earth years. Here the years of th Gods refers to the Sun as Deva is derived from Diva (Light} and the Sun is also called Divakara. THIS 15 WHERE THE ERROR CREEPS IN LE. THE IN- TERPRETATION OF THE TERM “YEAR OF THE GODS”. WHILE THIS IS GENERALLY ACCEPTED AS THE MOTION OF THE SUN IN ONE DAY, SOME HAVE EQUATED THIS TO ONE YEAR OF HUMAN LIFE. Thus, they misrepresent the periods as 4800, 3600, 2400 and 1200 human years instead. This is also the reason why I have been requesting the Software programuners to calculate the dasa-antar and other smaller periods correctly on the basis of the actual solar transit of 360 Degrees with fluctuations in one Year instead of interpolating on the figure of 365.25 days as a lot of approxi- ‘mation creeps in. Another blunder is to equate the year of the Gods blindly to 360 human years on the approximate basis of 1-Degree transit of the Sun per day when we know this to be 365.25 solar days. This is how another doubt of 360 days instead of 365.25 days per year has crept in --- ## Page 12 6 Vedic Remedies in Astrology Mahayuga of 12,000 years of the Gods or 4,320,000 earth years. This is the foundation stone of Vedic Astrology as it is perhaps, the least common multiple of the periods of revo- lution of the planets. Seventy-one Mahayuga’s form a -Manvantara (popularly called Manu} and fourteen Manvantaras constitute a day of Brahma called Kalpha. The day of Brahma is followed by an incidental dissolution called Naimittika wherein all living forms are only destroyed and after passing through the night of Brahma, creation again occurs The primary cosmic cycle is the Kalpha or day of Brahma equal to 4320 million earth years. Thus a day and “night of Brahma is 8640 million earth years. 360 such days’ make a year and Brahma’s life is said to be of 100 such years. At the end of the cycle of Brahma Prakrittika Mahapralaya occurs and everything including all matter and substance is dissolved. The cycle of Brohma is 311,040 Billion years after which another Brahma recreates the world from the - Navel of Narayana (World Spirit or Universal Soul, the infi- "nite God). The Zodiac as viewed from the earth with its 12 spokes demarcating the 12 signs represents the entire Uni- verse and is thus representing Narayana. Since the time quality cycle is for 120 years (two Jovian cycles of 60 years ` each), it can be represented by 120 degrees of the zodiac. ` Thus, there can be three portions of 120 degrees each start- . ing from zero degrees in Aries. These are the three navels . of the zodiac at zero, 120 and 240 degrees respectively called Brahma Nabhi. The zodiac also represents the hu- man being (Nara). Hence, Nara is said to be a replica of Narayana ` 1.2.4 Smaller cycles of time The dating of the Kali Yuga is the vexed question. Tra- dition accepts this as 3102 BC, whereas others relying on the other factors give 900 BC or 600 BC etc. How do we resolve this? Not going into other considerations, the 60- ‘the solar diurnal motion of one degree per day approx. Which was equated to a year. ॥1 --- ## Page 13

Year cycle of Jupiter and Saturn is considered very signifi- cant. The Yuga of Kali of 1200 Years of the Gods can be sub-divided into four sub-periods of 480, 360, 240 and 120 years of the Gods. We can again divide this into sub-sub- periods...and so on. Now, two such cycles of Jupiter-Sat- urn conjunction in Aries maybe called a “Chakra” with the first cycle called as Avaroha and the second as Aaroha. Thus the smallest measure of quality of time or “Chakra” is 120 solar years. These Chakra can again be grouped as Krta (Four Chakra}, Treta (three Chakra), Dvapara (Two- Chakra) and Kali (one Chakra) having periods of 480, 360, 240 and 120 solar years each and the Maha-Chakra will be for 1200 solar years. According to Sri Achyuta Dasa, the -“Dasatva (Bondage) of India ends in 2000 AD” showing that the Kali Chakra of 120 years that started in 1880 AD is to end in 2000 AD when Jupiter & Saturn are to conjoin in Aries again. Thus, this Maha-Chakra must have started ` 1200 years back in 800 AD. Further, the Krta Chakra should ` havebeen from 800 AD to 1280 AD and during this period the best temples were built and the finest literature pro- duced. This was tlie golden age of India. After this, Treta Chakra was from 1280 to 1640 AD during which we find that Satwa declines and strife increases. The Dasatva (Bond- age) of India begins as invaders came to rule and Muslim dynasty’s are set up in India. Dvapara Chakra was from 1640 to 1880 when the British directly ruled India under the Crown. With the advent of Kali Chakra (1880 to 2000 AD), the fight for freedom begins in the form Jf revival of religion etc. Strife is at its highest and has gone to the vil- lages as well. The main theme in India, the most spiritual Land, is still peace or a peaceful approach to freedom in the Aaroha (Increasing) portion of 60 years (1880 to 1940 AD} whereas in the Avaroha portion 1940 to 2000 AD even Mahatma Gandhi takes a war-like posture in the Quit In- dia resolution of 1942. The Kali Chakra (1880 to 2000 AD) has seen the development of the most powerful weapons for mass destruction (as well as their use in World War II}. Next --- ## Page 14 8 | Vedic Remedies in Astrology year, the entire cycle changes and another Maha-Chakra of 1200 Years begins with a Kreta-Chakra (2000 to 2480 AD) and once again, the temples will be built, litera- ture will flourish and a lot of good will happen on this planet.

The Brhadaranyaka Upanishad®® explains the Karma theory with reference to the theory of Transmigration of the soul (samsara). The pious and good souls who have lived ` a dharmic life depart for the abode of the forefathers and other such loka. After a period of temporary bliss, they move on to emptiness via the Moon. From emptiness, they de- scend to the earth with the rain and enter the food that is consumed by the prospective father. From the food they become spermatozoa and are offered to the prospective ` mother in the altar of fire (copulation). Then the birth oc- curs. The Upanishad adds that the unrighteous are incar- nated as birds, insects, animals or plants on the basis of the Karma of the past lives. It is generally taught that conduct and adherence to the moral code determined these changes. Thus good karma would promise an exalted future while bad karma will tend to degrade the soul in the lines of ˆ as you sow so will you reap’. This doctrine of Karma (literally “action”) provides a very satisfactory explanation for the various social inequalities that exist as well as the troubles or grief that one faces as it is the result of one’s own acts or misdeeds in the past. References galore in the sacred litera- ture where even the most evolved souls have to undergo punishment until deliverance. For example, two demi-Gods ~ had to reincarnate as Arjuna trees due to their misconduct of appearing nude in front of a sage and when the period of punishment ended, baby Krishna delivered them from the misery. Thus, if a chart is under the curse of a sage, the deliverance is achieved by worshipping Sri Krishna in Cn ‘Brihadaranyaka Upanishad VI,2.16 1 Sri Krishna is the lunar incarnation of Maha Vishnu the Universal soul as explained by Parasara in the Brihat Parasara Hora Shastra. --- ## Page 15

his baby form. In this manner, the intelligent jyotish'? can learn the remedial measures from the sacred literature. Some philosophers of recent times have expressed the opinion that a human being cannot be reborn as an animal or plant. This view is neither supported by the scriptures nor by as- trology. The Jaimini Sutra provides a vital clue for deter- mining the past life of any creature on the basis of the con- ception® chart. In the conception chart, Venus represents the sperm while Mars represents the ovum. The creature would have been a human being in the past life if Venus is | in a Manushya Rasi (human sign) in the Dwadasamsa chart ` 2-12 Chart) at the time of conception. If Venus is in a Keeta rasi (Insect sign), it would have been an insect and if in a chatuspada rasi (four-footed animal sign), an animal. If the past shows an animal or lesser jiva* and the concep- tion is of a human birth, then good Karna should be as- cribed to the past life for this up gradation while the re- verse holds true for bad karma. What comprises past Karma and how to decipher the same from the horoscope is the next question. The Bhagavat Gita explains that on the basis of the merits of past birth the Lord sends the souls to such Yoni’s (Physical bodies) and such parents as they deserve. Thus a human birth itself indicates good Karma in the past. Birth in the family of a king or a pauper, education and culture etc. all depend on the past Karma. The trines (1%, 5५ & 9* houses) indicate the past karma that shapes the fortune of the individual. The Sun and Jupiter are the natural significator of these houses. The presence of these significator in the trines does not damage the signification and instead is a blessing that shows good karma in the past. The presence of Rahu (op- posed to Jupiter) and Saturn (opposed to the Sun) in the trines damages the signification as it shows bad karma in

४ The horoscope drawn for the exact moment of copulation is the conception chart. Considerable details about the development of the fetus and parents can be determined from this chart. Kalyan Verma (Saravali) and Maharishi "` Jaimini (Upadesa Sutra) have spoken in detail on this subject. * creature --- ## Page 16 10 Vedic Remedies in Astrology the past birth. The three Arudha Pada of ascendant, fifth and ninth called Pada Lagna, mantrapada and Bhagya Pada also become very relevant in this context. Thus all the evil and sorrow that the native experiences in the present birth is on account of the bad karma of the past birth. The past karma of the individual is seen in the Rasi, Navamsa and Shastyamsa charts. The intrinsic nature of the individual and the abilities inherited from past life is seen in the ~ Shastyamsa (D-60) chart. It is for this reason that Parasara gives the highest weightage to the Shastyamsa chart in the vimsopaka bala (20-point strength) scheme. If either of these charts shows an evil influence, remedial measures become necessary. Similarly, details about the parents are seen from the fourth and ninth houses in the Rasi and Dwadasamsa {D-12 Charts). The Karma inherited from the matriarchal lineage is seen in the fourth house of the Khavedamsa (D-40 chart) (note'40=12*3 + वी while the Karma inherited from the patriarchal lineage is seen in the ninth house of the Akshavedamsa (D-45 chart) (note 45= 12*3 + 9). The remedial measures that one performs are also karma and the good karma in adequate measure envelops the bad karma thereby preventing its manifestation or al- ternatively burning the same. Suffering is the natural way of spending the bad karma and coming out clean. There can be innumerable ways to deal with the bad karma of the past and all these will fall in the category of ‘remedial measures’, All these methods can again, be categorized as Satwa, Rajas or Tamas on the basis of the Guna (attributes) of the remedy. All actions like recitation of holy scriptures, names describing the attributes of God, prayers, temple or church activities, feeding of the pious and the poor, charity to the pious and the needy fall in the category of Satwa Guna. All actions that are born out of ignorance and that cause harm to another creature or the environment can be broadly grouped as Tamas Guna. All actions that are per- formed due to a selfish desire or born out of passion are broadly grouped as of Rajas Guna. Since, the basic idea is to either envelope or burn the sins of the past, the karmic --- ## Page 17

chart. Considerable details about the development of the fetus and parents can be determined from this chart. Kalyan Verma (Saravali) and Maharishi "` Jaimini (Upadesa Sutra) have spoken in detail on this subject. * creature --- ## Page 16 10 Vedic Remedies in Astrology the past birth. The three Arudha Pada of ascendant, fifth and ninth called Pada Lagna, mantrapada and Bhagya Pada also become very relevant in this context. Thus all the evil and sorrow that the native experiences in the present birth is on account of the bad karma of the past birth. The past karma of the individual is seen in the Rasi, Navamsa and Shastyamsa charts. The intrinsic nature of the individual and the abilities inherited from past life is seen in the ~ Shastyamsa (D-60) chart. It is for this reason that Parasara gives the highest weightage to the Shastyamsa chart in the vimsopaka bala (20-point strength) scheme. If either of these charts shows an evil influence, remedial measures become necessary. Similarly, details about the parents are seen from the fourth and ninth houses in the Rasi and Dwadasamsa {D-12 Charts). The Karma inherited from the matriarchal lineage is seen in the fourth house of the Khavedamsa (D-40 chart) (note'40=12*3 + वी while the Karma inherited from the patriarchal lineage is seen in the ninth house of the Akshavedamsa (D-45 chart) (note 45= 12*3 + 9). The remedial measures that one performs are also karma and the good karma in adequate measure envelops the bad karma thereby preventing its manifestation or al- ternatively burning the same. Suffering is the natural way of spending the bad karma and coming out clean. There can be innumerable ways to deal with the bad karma of the past and all these will fall in the category of ‘remedial measures’, All these methods can again, be categorized as Satwa, Rajas or Tamas on the basis of the Guna (attributes) of the remedy. All actions like recitation of holy scriptures, names describing the attributes of God, prayers, temple or church activities, feeding of the pious and the poor, charity to the pious and the needy fall in the category of Satwa Guna. All actions that are born out of ignorance and that cause harm to another creature or the environment can be broadly grouped as Tamas Guna. All actions that are per- formed due to a selfish desire or born out of passion are broadly grouped as of Rajas Guna. Since, the basic idea is to either envelope or burn the sins of the past, the karmic --- ## Page 17

remedy should fall in the category of Satwa. If the karmic remedial measure is of Rajas Guna, the cure is temporary while if it is of Tamas Guna, the cure is very temporary and additional sin is incurred. The astrologer who gives Satwik advise is doing good karma and is blessed by Sri Vishnu® while the astrologer who gives the advise of tamasik remedies is punished by Sri Rudra (Siva). Astrolo- gers who fail to give any advise on remedial measure fallin the middle category of Rajasik karma and their efficacy as astrologers is always suspect. Itis evident from the above that mere remedial measures is not adequate and that the same should fall in the category of Vedic!” Remedies hav- ing the sanction of the Holy books, scriptures etc.

` There is no limit to the Karma that one can do and thus, the remedial measures that can be undertaken are limitless. There are certain books like the Red or Black Kitab that prescribe all kinds of remedial measures that can range from throwing a few kilograms of coal into the river to keep- ing a pot of water from the burial ground in the house! Most of the remedies prescribed in such books fall in the category of Rajasik Karma while a few are very Tamasik ® Parana teaches that God manifests Himself in three different forms due to yop (ion) with three forms of nature (Praknti personified as the Mother/ female gender). When the Yoga is with Satwik Shakti Sri Maha Lakshmi, the divine manifestation is as Sri Vishnu. When the Yoga is with Rajasik Shakti Sri Maha Saraswali, the divine manifestation is as Sri Brahma and when the Yoga is with Tamasik Shakti Sri Kali, the divine manifestation is as Sri Siva, Since the Lord Almighty (Narayana) is above these attributes (Gunas), wor- ship of Sri Siva & Sti Kali destroys Tamas and ones sins of the past. Simi- larly, the worship of Sri Brahma & Sri Saraswali removes the effect of Rajas and passion or desire no longer torments the mind. The worship of Sri Vishnu & Mahalakshnii maintains the individual in Satwa Guna at all times. These divine manifestations are worshipped by their beejakshara (seed syllables) namely, “A” for Brahma, “U” for Vishnu and “M" for Siva. Thus, the Beejakshara mantra (seed syllable) of the Almighty Narayana should be composed of these three syllables in the order of Birth (Rajas), Sustenance (Satwa) and Death (Tamas) and is the greatest Vedic mantra “AUM” (com- monly written and spelled as OM). . ¥ Lord Siva has various names describing His attributes or action. As Siva, He is the eternal purifier and destroyer of sins. Hence the famous Panchakshari mantra NAMAH SIVAYA . As Rudra, He is Lhe destroyer of sinners. ५ Vedic is derived from Veda meaning Knowledge and is squarely opposed to ignorance that causes Tamasik qualities. --- ## Page 18 ` 12 | Vedic Remedies in Astrology and should be totally rejected. Using these books for astrol- ogy or predictive purposes is one thing and prescribing rem- . edies is another. The pious Hindu is advised to keep the water from the Holy Ganges (symbol of Purity) in the house and the prescription of keeping of water from the burial/ cremation ground in the house is blasphemous. Thus, by following such remedies, the native ends up doing Karma, . which is opposed, to Dharma (duty as prescribed by the scriptures) and incurs sin. There are certain other books “generally termed as ghora tantra and falling in the category of black magic where all kinds of animal and human sacri- fices are indicated for fulfilling desires. The moot question ` is as to what extent the native is prepared to fall/ sell his soul to the Devil to achieve materialistic desires? History ` ` “has recorded the brave act of astrologers like Nostradamus who did not hesitate to set fire to the books of the Vulcan and have earned permanent glory. However, the dark forces will remain in existence during the Kali Yuga and it will be ~ the constant endeavor of all good men to rid this world of these forces.

ignorance that causes Tamasik qualities. --- ## Page 18 ` 12 | Vedic Remedies in Astrology and should be totally rejected. Using these books for astrol- ogy or predictive purposes is one thing and prescribing rem- . edies is another. The pious Hindu is advised to keep the water from the Holy Ganges (symbol of Purity) in the house and the prescription of keeping of water from the burial/ cremation ground in the house is blasphemous. Thus, by following such remedies, the native ends up doing Karma, . which is opposed, to Dharma (duty as prescribed by the scriptures) and incurs sin. There are certain other books “generally termed as ghora tantra and falling in the category of black magic where all kinds of animal and human sacri- fices are indicated for fulfilling desires. The moot question ` is as to what extent the native is prepared to fall/ sell his soul to the Devil to achieve materialistic desires? History ` ` “has recorded the brave act of astrologers like Nostradamus who did not hesitate to set fire to the books of the Vulcan and have earned permanent glory. However, the dark forces will remain in existence during the Kali Yuga and it will be ~ the constant endeavor of all good men to rid this world of these forces.

` Chart 1-1: Female born on 27 May 1967 at 5: 25 P.M IST at New Delhi (28N40; 77E13) Atmakaraka: Mer- cury; Arudha Lagna (AL): Aquarius; Upapada(UL): Capricorn; Mantrapada(AS5): Aries; Bhagyapada(A9): Aries. (>~

ASI XE --- ## Page 19 ` Introduction . 13 CX CHART 1-1 NAVAMSA In Chart 1, the Upapada (UL) represents the spouse and the Lagna of her husband is Taurus (trines to her Upapada). The Arudha Lagna is in Aquarius and the Upapada is in the twelfth house from the Arudha Lagna showing that the native will tend to ignore or reject the spouse. The Mantrapada (A5) is in Aries conjoined Rahu and subject to a paapakartari’® yoga between the Sun and Saturn. The Bhagyapada (A9) is also in Aries and the same situation obtains. During Rahu dasa Saturn Antardasa the native visited an uncle who is well versed in the Lal Kitab and was advised to visita cremation ground during a par- + ticular night and bury some Tantra articles. She was also gives some magical formulae (black magic mantra) to re- cite. All this was advised as she was passing through a difficult married life. The results were disastrous. The spouse was transferred to a remote locality and she ended up ina strange love affair with her boss. She contemplated divorce and even consulted lawyers. She had decided to forsake her children and spouse for marrying her boss. The boss, in turn sent his family away and decided to forsake his fam- ily, children and two other love affairs for her! At this juncture she called on the author with a com- mon friend to determine the outcome of the love affair. Ju- piter is exalted, in Cancer and will surely deliver her from sin. After she confirmed the above-mentioned incidents, # Sandwiched between; Pagpa means bad or sinful. --- ## Page 20 14 Vedic Remedies in Astrology she was categorically told to refrain from the evil practices. Since the prevalent Guna was largely Tamas, as per Vedic tradition it was necessary to rescue her from the clutches of the evil mantra and destroy Tamas by worshipping Sri Shiva or Sri Kali. Durga is a form of the divine Mother who destroys darkness and delivers one from sin. For this pur-. pose, the 17 syllable Kalpavriksha Mantra™ of Durga is most effective and she was asked to chant the mantra till the end of Rahu dasa Saturn antardasa. The fight against the evil and the emotional turmoil that she underwent is be- yond description. With the advent of the antardasa of the Atmakaraka Mercury the going became easy as although the AK tends to punish, it will always take the native on the divine path. She was asked to write the Beejakshara Mantra? of Sri Ganapati® and within a month of doing ` 50, her spouse was transferred back to hometown. She de- veloped the character and strength to ask her paramour to get out of her life and took up a job to augment family income. All's well that ends well. The tears and turmoil that the astrologer has to share for about a year and a half seem to be well compensated in the end as it reinforces faith in the Almighty. There maybe cases where the people who have visited the Lal Kitab for consultation have got temporary relief, but there is no doubt that they have only deferred the debt of bad karma and will have to pay for the same with inter- * Kalpavriksha is the celestial tree that grants any boon. In the Human body. it is the Kundalini Shakti in the spinal chord. The roots of the Celestial tree are in the Mooladlara Chakra in the base of the spine and its branches and leaves with fruits in the Safwsrara Chakra in the brain, The Kalpavriksha mantra is “ OM HRIM SRIM KRIM DURGATINASINYAI MAHAMAYAYAI SVAHA". ॐ हीं श्रीं की दर्गतिनाभीन्ये महामायायै स्वाह्म | ग The Becjakshara of Sri Ganapati is “GAM” and the mantra is ~ OM HRIM GAM HRIM MAHAGANAPATAYE NAMAH SVAHA". ॐ हीं 7 हीं महागणपतये नमः स्वाहा | य Sri Ganapati is the elephant headed son of Sri Shiva. Belonging to the divine family that delivers the soul from darkness and sin, the specific function of Sri Ganapati is to teach and drive away ignorance (वपष). He is represented by Ketu the significator of emancipation from all kinds of bondage including rebirth. . --- ## Page 21

est. Normally during the period of Rahu a native likes to learn about such occult practices and reads such books.

Vedic Astrology uses the system of harmonic divisional charts called Varga. Kalyan Verma (Saravali 3.12) expresses the importance of divisional charts. He opines that the di- visional charts provide complete knowledge (enlighten- ment) on the bhava’s, without which it is impossible to take even a siep into this great science (of astrology). Thus, it is evident that the divisional charts hold the key to predic- tions and understanding the horoscopes. The birth of twins ‘provides the greatest challenge to all astrologers. The gen- ‘eral concept that the Rasi chart is the be all and end all of Jyotish takes a beating as the Birth Chart and sometimes even the navamsa charts of twins are invariably the same, yet their fortunes, looks etc are totally different. It becomes amply clear that there is yet another chart that is far more important than the Rasi & Navamsa Charts. This is the Shastyamsa Chart (D-60) as Parasara gives the highest weightage to this chart under the Vimsopaka Bala scheme {20-Point strength based on divisional dignities). We must respect the teachings of the Maharishi’s, and then the knowledge will unfold. Every facet of life finds place in one of the twelve signs of the zodiac and the twelve houses of the horoscope. This results in the clubbing of many aspects in a particular house or sign thereby making the interpretation very subjective. Assigning natural lordships to planets over individual mat- ters (Naisargika Karakatwa) supports this. For example, the fourth house rules over properties, mother, home, happi- ness, vehicles, formal education etc. While the examina- tion of the Bhava may not be able to give a clear-cut picture and additional examination of the natural significator like ` Moon for mother, Venus for vehicles, Mars for properties, Ketu for home etc. will make the reading easier, but defi- nitely not affirmative. This is where intuition steps in and the gifted astrologer is bailed out. If the invaluable tool of --- ## Page 22 ` 16 | ` (दाद Remedies in Astrology ‘divisional chart were added, the reading would not only ` be accurate, but quite detailed. Since the twelve sign division is the primary division, it follows that all sub-division of the sign will fall in a se- quence that repeats after every twelve divisions. Thus, for example, the D-16 Chart (Shodasamsa or Kalamsa) will be the first harmonic (or second cycle) of the D-4 Chart (Chaturthamsa). This can be expressed mathematically as 16 = (12 x [+ (4); where 1 represents the first harmonic. Similarly, the D-40 (Khavedamsa) Chart is the third har- monic (or 4५ cycle) of the D-4 Chart as 40 = (12 x 3) + (4).

Divisional | Charts range

, Cycle/ Harmonic Consciousness i Physical Primary ॥ (D-1 to D-12) Conscious Secondary/ First harmonic (D-13 to D-24) Sub-Conscious Tertary/ Second harmonic (D-25 to D-36) Super- Conscious Quaternary/ Third harmonic (D-37 to D-48) Supra- Conscious Pentenary/ Fourth harmonic (D-49 to D-60) The first cycle of divisional charts from Rasi chart (D- 1) to Dwadasamsa (D-12) rules over the physical plane and covers such matters as physical body (D-1), material wealth (D-2), brothers & sisters (D-3), immovable proper- ties (D-4), children (D-7), authority over others (D-5), spouse (D-9), work (D-10) and parents (D-12). The second cycle or first harmonic rules over the conscious plane. Technically it covers charts D-13 to D-24, but Parasara has restricted the scope to the three primary areas of mental activity namely Shodasamsa or Kalamsa (D-16) ruling over matters of general mental happiness, luxuries, vehicles etc; Vimsamsa (D-20) wherein spiritualism, occult studies etc are examined and Chaturvimsamsa (D-24) for all kinds of learning (which is actually considered a heritage from the society). The third cycle or second harmonic rules over the sub-conscious plane covering charts D-25 to D-36. Parasara advises us to focus on two charts in this group, namely, Nakshetramsa (D-27) for strengths & weaknesses --- ## Page 23

and Trimsamsa (D-30) for all evils. For example if the Moon is exalted and placed in a quadrant in the D-27 Chart, we can infer that the native is mentally very strong. A weak Mercury in this chart can show speaking disorders or a weak speech. The fourth cycle or third harmonic rules over the super-conscious plane covering charts D-37 to D-48. However, the good & bad accruing to the destiny of the individual due to the Matrilineal karma (seen from Khavedamsa D-40 Chart as 40 = (12x3) + 4) and that from the Patrilineal Karma (seen from the Akshavedamsa 12-45 Chart as 45 = (12x3) + 9) are considered important in the Shodasavarga scheme of Parasara. The fifth cycle or fourth harmonic rules the supra-conscious plane covering the charts D49 to D-60. At this level, the heritage (equivalent of D-12) of the karma from past births is relevant and the Shastyamsa (D-60 Chart) is vital. Parasara gives the high- est weightage to this chart in the Shodasavarga scheme. There are much higher planes of Consciousness and some other divisional charts like the Nava-Navamsa (D-81), Ashtorramsa or Navamsa-Dwadasamsa (D-108) and Dwadasamsa-Dwadasamsa (D-144) are used. A detailed dis- cussion on the divisional charts is beyond the scope of this book. Suffice is to say that the scheme? of Parasara em- ploys the most vital 16 charts. These are the Rasi (D-1: Physi- . cal body), Hora (D-2: Wealth), Drekkana (D-3: Co-born), Chaturthamsa (D4, fortune, properties), Saptamsa (D-7: children), Navamsa (D-9: Self & spouse), Dasamsa (D-10: Power, Career & Profession), Dwadasamsa (D-12: Parents & elders), Kalamsa (D-16: Vehicles, all luxuries & happi- ness), Vimsamsa (D-20: Worship and spiritualism), ख There are other schemes depending on the extent and depth of study to be done on the chart. The scheme of Jaimini adds the Shastamsa (D-6: enemies), Rudramsa (D-11) and Panchammnsa (D-5) charts to the Parasari scheme and thus, does not deviate from the primary usage of the divisional charts. Some other [ater day astrologers advise the use of Dasavarge (Ten divisional charts: Jataka Parijatha) while others recommend Shadvarga (Six divisional charts) and Saplevarga (Seven divisional chart) schemes. Some astrologers have also differed on the methodology of construction of the divisional charts while others have differed on its usage like recommending the Dreldkana (D-3 chart) for Karmaphala (Results of deeds or profession) instead of co-bom. --- ## Page 24 18 ः Vedic Remedies in Astrology Siddhamsa (D-24: Education & all learning), Bhamsa (D-27. strengths & weaknesses), Trinisamsa (D-30; all evils), Khavedamsa (D-40: Matrilineal Karma showing good / bad), AkShavedamsa (D-45: Patrilineal karma showing good/bad) and Shastyamsa (D-60: Own past Karma showing good/ bad). The Brihat Parasara Hora Shastra gives the names and presiding deities of these divisions of the zodiac. Accord- ing to Satyacharya’s®’ principle for Vinisottari dasa, the dasa lord acts as the Sun. By extension, the antardasa® lord acts like the Moon and the Pratyantar dasa lord acts as the Lagna. The divisional deities provide the clue to propitia- tion during the Vimsottari dasa and sub-periods. For ex- ample, if during a particular antardasa the native suffers from a setback in career, the deity of the Dasamsa (D-10 chart) occupied by the planet governing the antardasa should be propitiated for immediate relief.

The constellation (called Nakshetra) plays a key role in Vedic Astrology providing common links, initiating the Vimsottari dasa and for various purposes of Natal, Annual and Horary astrology. For example, if the lords of the as- cendant, tenth and the Sun are in the same constellation or occupy constellations owned by a common planet (as per Vimsottari dasa scheme), then a powerful Rajyoga is caused. However, if the constellation dispositor is ill placed, Rajyoga will be felt only during its periods. Thus, it becomes impor- tant to enhance the influence of the constellation dispositor either by the use of a gem or by propitiation. The sign dispositor of a planet is called its Deha (Body) while the constellation dispositor is called its Jeeva (Life force). Thus if the sign dispositor of the ascendant lord is placed in the. 2०५, 6५, ६५ or 12५, house, ill health is expected during the periods of the dispositor as the Deha is afflicted. Similarly, B Satya Jataka of Salyacharya, It provides valuable insight into interpreting the Vimsottari and other dasa as well as longevily analysis. An important ` ` text of Vedic Astrology. -ॐ Also called Bhukti, it is the sub-period. = Sub-sub period. , --- ## Page 25 ` Introduction । : 19 if the constellation dispositor of the ascendant lord is ill placed the fortunes of the native take a nosedive. In both cases, suitable remedial measures are necessary. Presiding deities of the constellations and their mantra are given in the Appendix C.

Chart 1-2:Male born on 7 August 1963 at 9.15’ PM IST at Lat: 2IN28' & Long: 8401. . : : .

In chart 1-2, the Lagna lord and tenth lord is Jupiter placed in its own sign in Pisces in Revati Nakshetra ruled by Mercury. The Rajyoga Karaka Sun 15 2150 placed in trines in the fifth house in Aslesha constellation ruled by Mer- cury as per the Vimsottari dasa. Thus, Mercury becomes an important Jeeva for the tenth house and Rajyoga should be expected during its periods. However, its placement in the sixth house and being subject to a Papakartari yoga between the Sun and Mars makes it weak in position. A substantial portion of the negatives are removed by its place- ment in vargottama Navamsa and being in mutual aspect with the fifth lord Moon gives another fine Rajyoga due to the mutual aspect between 4५, 7* & 5" lords. Mercury is also placed in the 12५ house from the Atmakaraka and shows the spiritual inclination as Sri Vishnu or Bhagavan Krishna.

--- ## Page 26 20 : Vedic Remedies in Astrology sulted and the family was elevated to a very high status. However, the Rajyoga was destroyed due to politics with the advent of Ketu antardasa in Saturn dasa. Thus, in or- der to strengthen the Rajyoga, it will be most advisable to worship the Kula devata (Mercury is 4" Lord) and Sri Vishnu The birth constellation is called the Janma Nakshetra and remedial measures should be undertaken after a care- ful consideration of the Tara Bala and other Horary astrol- ogy considerations. Replies to some frequently asked ques- tions (FAQ) as well as questions like how does a mantra . work etc. ean be found in Appendix 5

--- ## Page 27 ॐ गुरवे नम CHAPTER II ASTROLOGY AND DEITY

Maharishi Parasara is considered the father of Vedic Astrology and his views on worship or remedial measures are outlined in the subsequent paragraphs. Since Parasara is also a Rishi (Author and Seer) of the Rig Veda, his contri- . bution is the authentic view on remedial measures. 2.1.1 Planets & deities After explaining the creation, Maharishi Parasara has taught that based on the effect of the planets Sri Vishnu has appeared as different Avatar’s to protect and sustain this creation. The table 2.1 gives the holy names (Avatar or reincarnations) of Sri Vishnu as given by Parasara. Al- though later day authors have given another list, their au- thenticity is doubted. Parasara has also given the names of the Devata (Deities) of the planets (Table 2.2). These are the deities’ represented by the planets and have a different - usage. The detailed description of the Dasa Avatar are be- yond the scope of this book and readers can refer to Srila Prabhupada’s translation of the Srimad Bhagavatam for more details. : --- ## Page 28 .22 ~ Vedic Remedies in Astrology

After explaining the creation, Maharishi Parasara has taught that based on the effect of the planets Sri Vishnu has appeared as different Avatar’s to protect and sustain this creation. The table 2.1 gives the holy names (Avatar or reincarnations) of Sri Vishnu as given by Parasara. Al- though later day authors have given another list, their au- thenticity is doubted. Parasara has also given the names of the Devata (Deities) of the planets (Table 2.2). These are the deities’ represented by the planets and have a different - usage. The detailed description of the Dasa Avatar are be- yond the scope of this book and readers can refer to Srila Prabhupada’s translation of the Srimad Bhagavatam for more details. : --- ## Page 28 .22 ~ Vedic Remedies in Astrology

1Graha

| |

Devata Indra Sachi Devi? Brahma Jupiter Agni (Fire) Jala (Water) Skanda (Kartikeya) Venus Saturn Moon 2.1.2 Remedies for Adverse Dasa Maharishi Parasara has also given detailed remedial measures for all kinds of problems. Table 3.2 gives his views on the basis of the Dasa-Antardasa. ।

Maharishi Parasara has also given detailed remedial measures for all kinds of problems. Table 3.2 gives his views on the basis of the Dasa-Antardasa. ।

Table 2-3 Worship for dasa effects.

If Lord of रे or 7% houses or placed in these houses Mritunjaya mantra Surya (Sun God), Aditya Hridaya Mantra —_— ~~~ 1 Gri Kalkin Avatar has not yet appeared and is expected at the end of the present Kali Yuga, 2 Gachi Devi is the wife of Indra the Lord of all the Deva’s (Deities). * Ghee: Clarified Butter 4 Yagna: Fire Sacrifice done by the Agnihotri's or Brahminical priests. Cow, Female buffalo; Rice, Ghee? & Curd at the Yagna!

--- ## Page 29

Mercury

Grains Ista Devata, Shiva Sahasranama

Jupiter

Lakshmi Venus Sesamum oil lamp in the evenings to overcome drowsiness and weak- nesses.

Mritunjaya Mantra

21.3 Astakavarga Remedial measures for solar transit in signs having low rekha’s (score) in the Sarva-Astakavarga (SAV). The re- medial measure should be performed on an auspicious day ruled by the lord of the sign or the day of worship of the deity, as the case maybe, when the Sun transits the sign ‘with the low SAV score. For example, if Virgo has a score, then the date should be between 15 September to 15 Octo- . ber (Transit Sun in Virgo). The remedial measure as given in table 2.4 should be prescribed. This maybe expensive for some persons and they may spend as per their means only. For the benefit of the readers, the names of the Rishi’s¢, the . Sun etc have also been given in table 2.5.

Remedial measures for solar transit in signs having low rekha’s (score) in the Sarva-Astakavarga (SAV). The re- medial measure should be performed on an auspicious day ruled by the lord of the sign or the day of worship of the deity, as the case maybe, when the Sun transits the sign ‘with the low SAV score. For example, if Virgo has a score, then the date should be between 15 September to 15 Octo- . ber (Transit Sun in Virgo). The remedial measure as given in table 2.4 should be prescribed. This maybe expensive for some persons and they may spend as per their means only. For the benefit of the readers, the names of the Rishi’s¢, the . Sun etc have also been given in table 2.5.

i नर AL MEASURES

«7 Death Like suffering Donate 20 Tola’ gold & twa heaps af sesame .8 Death Like suffering Donate camphor equal to your weight कर Jagadamba refers to the Divine Mother or the Sapta Matrika {Seven Mothers feeding this universe). ,५ Rishi’s refers to the saints. ? Tola is equal to 10 gms. Thus 20 tola is about 200 gms of gold. --- ## Page 30 24 10 11 12 13 14 15 16 17 1.8 19 20 21 22 23 24 25 26 27 28 29

Danger from snakes Weapon injury Disgrace

Danger from wild animals/ canines Death Anger of the King/ Government.

हि

Banished or compelied by circumstances to leave ones home Dull-witted/ loss of memory or intelligence Disease Kith & Kin in distress

Torment & distress

Death of relatives & friends

Loss of wealth Loss of wealth All kinds of losses Anxiety Gift an idol of the Sun God in a chariot with seven horses

bolt Donate an idol of the Moon made of 10 tola gold

Donale some Land full of crops

Donate a Saligrama

Donate a Varaha® Mootti of Gold

Donate a Kalpavrikshal® made of gold Donate a cow and Jaggery

gold Worship the Kula Devata (family deity). Goddess Saraswati should be worshipped. Heap of grains Donate some gold Donate an idol of the Sun made of 7 tola of gold

Donate 10 cows

Worship Sri Saraswati

Recite the Sri Saokta/ Worship Lakshmi Worship the Sun God

! Saligrama: A polished stone representing Sri Vishnu १ The Varaha Avatar is an incarnation of Lord Vishnu represented by Rahu. He has a face of the wild boar. Varaha Moorti refers to an idol of Sri Varaha Avatar (Tirupati Balaji). ® Kalpavriksha refers to the Holy Tree (symbolically) growing upside down in the abode of Lord Indra (King of the Gods). The roots are in heaven and the branches, leaves and fruits stretch down to the earth. --- ## Page 31

has a face of the wild boar. Varaha Moorti refers to an idol of Sri Varaha Avatar (Tirupati Balaji). ® Kalpavriksha refers to the Holy Tree (symbolically) growing upside down in the abode of Lord Indra (King of the Gods). The roots are in heaven and the branches, leaves and fruits stretch down to the earth. --- ## Page 31

Ew (त

ST --- ## Page 32 26 की : Vedic Remedies in Astrology 2.1.5 Deities of Divisional Charts Maharishi Parasara has given us exhaustive details on the deities for the divisional charts. The use of these charts and the prescription of remedial measures on the basis of the deities are outlined in subsequent chapters. 2.1.5.1 Rast CHART: (D-1) The Rasi’s are lorded by the planets and the Sun is the overlord of all the signs. Thus most remedial measures for good health of the physical body prescribe the worship of the Sun. Various deities as per Table 3.6 rule the Nakshetra (Constellation). The Moon is the Overlord of all the Nakshetra. Thus most of the remedial measures for main- tenance of good mental health prescribe the worship of the Moon. Now Maharishi Parasara teaches that the Sun rep- resents Sri Ram while the Moon represents Sri Krishna. Hence the best mantra for maintaining good mental and physical health is the Janak Shadakshara" ^ HARE RAM- KRISHNA” (हरे रामकृष्ण).

Maharishi Parasara has given us exhaustive details on the deities for the divisional charts. The use of these charts and the prescription of remedial measures on the basis of the deities are outlined in subsequent chapters. 2.1.5.1 Rast CHART: (D-1) The Rasi’s are lorded by the planets and the Sun is the overlord of all the signs. Thus most remedial measures for good health of the physical body prescribe the worship of the Sun. Various deities as per Table 3.6 rule the Nakshetra (Constellation). The Moon is the Overlord of all the Nakshetra. Thus most of the remedial measures for main- tenance of good mental health prescribe the worship of the Moon. Now Maharishi Parasara teaches that the Sun rep- resents Sri Ram while the Moon represents Sri Krishna. Hence the best mantra for maintaining good mental and physical health is the Janak Shadakshara" ^ HARE RAM- KRISHNA” (हरे रामकृष्ण).

There are various methods for drawing the Hora Chart for various purposes. However, there is unanimity in the overall lordship of the Hora. The Sun is the overlord of the first Hora in odd signs and second Hora ineven signs whereas the Moon is the overlord of the second Hora in odd signs and first Hora in even signs. Thus, as explained above, the best Mantra for daily worship and remedies per- taining to the Hora chart is also the Janak Shadakshara Mantra. 1 Rishi anak was the father of Sita, the wife of Sri Ram. Shad-Akshara refers to the six-lettered mantra given by Rishi Janak. This is also the Guru mantra of the Jyotish Parampara of Orissa as given by Sri Achyuta Dasa. This mantra ,- is the root for the Mahamantra: HARE RAM HARE RAM RAM RAM HARE HARE HARE KRISHNA HARE KRISHNA KRISHNA KRISHNA HARE HARE. 2 Hora is one half of a sign measuring 15°. There are various methods to draw Hora charts and readers can refer to my translation of Jaimini Maharishi's Upadesa Sutra. ॥ --- ## Page 33

Tees us ttarius| com rius FF ll 1 15 5 4 5 4 4 5 15 to | Moon | Sun Sun Moon | Sun Moon 30 4 5 5 4 5 4 Pisces

iT --- ## Page 34 28 Vedic Remedies in Astrology

The three sages Brahmarshi Doorvasa, Maharshi Agastya & Devarshi Narada are the deities of the three types of Movable, Fixed and Dual Drekkana® respectively.

£ —

नयु (6 17 (8 | [9 (10 / 11 | [9 [10 | [2 [3 [4 | Note: Movable signs 1,4,7,10: Rajas Guna Manushya, Deity: Sri Doorvasa Fixed Signs 2,5,8,11: Tamas Guna Rakshasa Deity: Sri Agastya Dual Signs 3,6,9,12: Satwa Guna Deva Deity: Sri Narada

The four Vaishnava Sanaka, Sananda, Kumara and Sanatana are the deities of the four Chaturthamsa of a sign.

wu = r= ठि = छा पि 10 | 14 | 121

४ Drekkana is the one-third division of a sign measuring 10, The first Drekkana is in the same sign, the second in the 5% and third in 9% from it. ५ Chaturthamsa is the One-fourth division of a sign measuring 7°30' each. The first Chaturthamsa is in the sign itself, the second in the fourth house, the , third in the 7* house and the fourth in the 10५ house. --- ## Page 35

is in the same sign, the second in the 5% and third in 9% from it.

first Chaturthamsa is in the sign itself, the second in the fourth house, the , third in the 7* house and the fourth in the 10५ house. --- ## Page 35

Astrology and Deity `". 29

The seven Rasa'® Kshaara (Bitter), Ksheera (Milk), Dadhi (Curd/ Yoghurt), Ghrita (Ghee or clarified butter), Ikshu Rasa (Sugarcane juice}, Madhu (Honey), Suddha Jala (Pure Water) rule the seven divisions in an odd sign. In an even sign, these seven lordships are reversed.

i = = od -— [3 पा श्‌ श 1119 Rasa [6 |8[10i2]2 [4 | [30 दाद 12 1917117 13 [5 14/23 ]

The navamsa? falling in fixed signs are called Rakshasha (Tamas), in movable signs are called Manushya (Rajas) and in dual signs are called Deva (Satwa) being presided by Shiva, Brahma & Vishnu respectively. ४ Saptamsa is one-seventh division of a sign measuring 4° 179" each, These are reckoned from the sign itself for odd signs and from the seventh house for even signs. ¥ Rasa refers to nectar and the seven types of nectar are further over lorded by the Divine Mother Saraswati who is the wife of Brahma, the Creator. Since Saptamsa deals with the act of creation, Saraswati and the specific Rasa are worshipped and consumed. ¥ One-ninth division of a sign measuring 3° 20 of arc. Reckoned from the movable sign in trines to it. --- ## Page 36 30 : Vedic Remedies in Astrology

reckoned from the sign itself for odd signs and from the seventh house for even signs. ¥ Rasa refers to nectar and the seven types of nectar are further over lorded by the Divine Mother Saraswati who is the wife of Brahma, the Creator. Since Saptamsa deals with the act of creation, Saraswati and the specific Rasa are worshipped and consumed. ¥ One-ninth division of a sign measuring 3° 20 of arc. Reckoned from the movable sign in trines to it. --- ## Page 36 30 : Vedic Remedies in Astrology

ng] 0 [A (© | ग © 8 cle |B ४ (82155 f) [4] (5 12 111 18 [5 | (6 (3 11219 6 | | 10 | 18 [5 [2 [11 [8 | (9 [6 (3 [12 [9 | |1 | 10 | (8 |5 |2 | 12 19 16 [3 | 1 Note: Movable signs '1,4,7,10: Rajas Guna = Manushya, Deity: Brahma Fixed Signs 2,5,8,11: Tamas Guna Rakshasa Deity: Shiva Dual Signs 3,6,9,12: Satlwa Guna Deva Deity: Vishnu

f) [4] (5 12 111 18 [5 | (6 (3 11219 6 | | 10 | 18 [5 [2 [11 [8 | (9 [6 (3 [12 [9 | |1 | 10 | (8 |5 |2 | 12 19 16 [3 | 1 Note: Movable signs '1,4,7,10: Rajas Guna = Manushya, Deity: Brahma Fixed Signs 2,5,8,11: Tamas Guna Rakshasa Deity: Shiva Dual Signs 3,6,9,12: Satlwa Guna Deva Deity: Vishnu

The deities of the Dasamsa are the ten Digpalaka or the ten lords of the directions. These are the eight surface directions, the vertical upward and the vertical downward. The Dasamsa rules the profession/ vocation of the native and gives the direction of life. The names of the ten divi- sional deities of odd signs are Indra (E), Agni (SE), Yama (S), Rakshasha (SW), Varuna (W), Vayu (NW), Kubera Table 2-11: Dasamsa| 3" ODD SIGNS [EVEN SIGN (4 [6 18 [Ananta ~ Brahma EN [9 | 12 [2 [4 |6 [8 [10 [79302 - 12 | Rakshas 6 [8 {10 12 2.13 3 [5 [7 [१ [17 [८५067 कफ,

7/9 Ji1[1 [3 15 [4 [5 [8 [10 | 12| Rakshas 24 Agni __ 1s [Indra ५ One-tenth division of a sign measuring 3° of arc. Reckoned from the sign itself ` for odd signs and from the ninth house for even signs के The SW direction is called Nirttiti but is ruled by Rakshasha (Demon). The other names are synonymous with the names of the directions. --- ## Page 37

(N), Isana (NE), Brahma (Vertical downward) & Anantha (Vertical Upward). For even signs, the dieties are reversed {.e. the first is presided by Anantha and the last by Indra.

This divisional chart is used to determine the Gotra (lineage) and Kula (dynasty/ family) of the native. The di- visional deities are Ganesha, Ashvini Kumar, Yama and Sarpa repeating thrice. This order is applicable for both odd and even signs. . . .

Sagittarius Capricom Asvinis’ ama ~ [नब ~~: EY | FY =+ | पे Yi ५ | Sarpa__| 1 गे (>)

This divisional chart is used to determine the level of mental happiness and luxuries in the life of the native. The divisional deities Aja (Brahma), Vishnu, Hara (Shiva) and Surya repeating four times for odd signs. In the case of even signs, the deities are reversed i.e. Surya, Hara (Shiva), Vishnu and Aja (Brahma) repeating four times. क Jwadasamsa: One-twelfth division of a sign measuring 2° 30" of arc. Always reckoned from the sign itself. : "ॐ Kalamsa is also called the Shodasamsa and is the one-sixteenth division of a sign measuring, 1°52' 30" each. These are reckoned from Aries for movable signs, from Leo for fixed signs and from Sagittarius for Dual signs. --- ## Page 38 32 ` Vedic Remedies in Astrology क | {+ | = | (५ | ८) ~ | ८3 | | ५ ©] +| ९५ = a विन = 9 ~N Wis = Ei Enjlel}l ००५०९२९५

isnu Visn Aja Sur 30-0-0 [4 11218 [4 11218 |

7-30 28 ०4896 25-15-0 (10 (6 [2 [10]6 | [Aja [1 9 (5 [1 Jo [5 | 22-30-0 [Surya [1218 |4 [12]8 |4 | 16-52-30 (9 [5 [1 [9 |5 |1 |Surya| 7 Visnu 18-45-0 (68 |2 (10 |€ | [6 |2 1016 2 3 15-0-0 (8 |4 [1218 [4 । 12 --- ## Page 39

Astrology and Deity 33

The Divine Mother rules Upasana (Spiritual desire). .Adi Sankara had prayed for Her guidance in the lines ^ Gatistwam Gatistwam Twam Eka Bhavani”. Maharishi _Parasara has given the forms that She appears in to guide ‘the people into the spiritual path. For odd signs, the Divi- sional deities reckoned from the first, are Kali, Gauri, Jaya, Lakshmi, Vijaya, Vimala, Sati, Tara, JwalaMukhi, Sveta, “Lalitha, BagalaMukhi, Pratyangira, Sachi, Raudri, Bhavani, Varada, Jaya, Tripura and Sumukhi. For even signs, the Divisional deities are Dayaa, Megha, Chinnasi (Chinnamasta), Pisachini, Dhoomavathi, Matangi, Bala, ‘Bhadra, Aruna, Anala, Pingala, Chuchchuka, Ghora, Vaarahi, Vaishnavi, Sita, Bhuvaneswari, Bhairavi, Mangala ~ and Aparajita. Table 2-14: Vimsamsa EVEN SIGNS 0070 SIGNS _Chhinna _ Pishachi , Dhuna © |~ ©| ~ [श 9 १११।११७०.०१७।०१० ०१ 7 2 22 निनब888- 2 1 | [2 | 13] [4 | [5 | [6 | M i [Sati | i= | 9 | Jwa.Mukhi Aruna न Lalita [२ Plngala 12 | Bagla

_Shachi | 6 | Varahi ९३५५1 _ 2 | Valshnavi { 16 | Bhavani | 8 [ऽ | NVarda | [8 | Tripura 7 3 11 | Mangala [20 | Sumukhi [8 [12 | 4 [8 | 112 | Aparajita 2 Vimsamsa is the one-twenticth division of a sign each measuring 1°30" of arc. These are reckoned from Aries for Movable signs, from Sagittarius for Fixed signs and from Leo for Dual signs. --- ## Page 40 34 Vedic Remedies in Astrology

This divisional chart is examined for educational at- tainments. The deities for the divisions in an odd sign are ` the twelve of Skanda, Parsudhara, Anala, Vishwakarma, Bhaga, Mitra, Maya, Antaka, Vrishab-Dhwaja, Govinda, Madana & Bhima repeating twice (12*2=24). The deities for the even signs are in the reverse order starting from Bhima and repeating twice.

This divisional chart is examined for strengths and weaknesses. The lords of the 27 divisions of a sign (which is equal to the one-twelfth division of a constellation) are given by the lords of the 27 constellations. These are the Dastra (also called Aswini Kumar), Yama, Agni, Brahma, Chandra, Isa, Aditi, Brihaspati (also called Jeeva), Ahi, Pitara, Bhaga, Aryama, Surya, Tvastha, Marut, Sakragni, Mitra, Vasava, Rakshas, Varuna, Viswadeva, Govinda, Vasu, Varuna, Ajaikapada, Ahirbudhanya and Pusha for the 27 constellations starting from Aswini (1).

This chart is used to determine evils. The Trimsamsa lords are Mars (5% Saturn (5°) Jupiter (89, Mercury (7%) and Venus (5% for odd signs and the reverse for even signs. The deities accordingly are Agni, Vayu, Indra, Kubera and Varuna for odd signs and the reverse for even signs. ४ Siddhamsa is also called Chaturvimsamsa and is the one-twenty-fourth division of a sigh each measuring 1° 15' of arc. These are reckoned from Leo or Cancer depending, on the sign being, Odd or Even. ५ Bhamsa is also called Sapta-Vimsamsa and is the one-twenty-seventh divi- sion of a sign. It is also called Nakshetramsa as there are 27 constellations and shows the mental strengths and weaknesses. It measures 1%'40" of arc "and is reckoned from the four movable signs Aries, cancer, Libra & Taurus ` depending on the nature of the sign of placement as Fire, Earth, Wind or Water. . --- ## Page 41

division of a sigh each measuring 1° 15' of arc. These are reckoned from Leo or Cancer depending, on the sign being, Odd or Even.

sion of a sign. It is also called Nakshetramsa as there are 27 constellations and shows the mental strengths and weaknesses. It measures 1%'40" of arc "and is reckoned from the four movable signs Aries, cancer, Libra & Taurus ` depending on the nature of the sign of placement as Fire, Earth, Wind or Water. . --- ## Page 41

Table 2-15: Siddhamsa

४ © ७ 2 क e | 2 2 hd पा 2 ५५ a | £ पट = o Tc % 5 © (= © © a 3 क < 2 © © @ a ५ श् © or © =+ 0 | = ८0 पी ८ ~ 1 | Skanda [5 [4 [5 [थे [5 | (4 ।5 ।4 [5 | hima | 1/15 | | 2 | 2/30 Pashudhar [6 |5 16 |5 | 6 | | 5 |6 |5 |6 | |: Madan [3 [3/45 (6 [7 16 [7 [6 | (6 [7 [6 | Govind 3/45 [5/0 [Vishvaka [8 [7 [8 |7 |8 [7 [8 | | 8 |7 |v.Dhwaj [5/0 | ६ 100 हरी Hots Tole (74 9 (5 [6 7/30 | Mitra 110 [9 10 10 10 [9 [10 {9 | Maya 7/30 | 8/45 | Maya [11 [10 [11 [10 [11 [10 [11 [10 | 11 115} (8 [10/0 J Antak [12 [11 12 [11] 12 [11 [12 [11 {12 | 11 | [9 111/15 [v.Dhwaj |1 [12 |} T9213 [42 [1 12 {1 1121; (2 [1 (2 [1 T2 Jv [2 [1 T2 11 12 [1 13 12 13 2 13 12 [3 [2 3 [2 [3 [2 | [4 [3 14 [3 | (3 [4 |3 [4 [3 | 15/0 (13 [16/15 [Skanda दि [4 15 [4 [5 [4 [5 [4 |5 [4 [5 | 16/15 (14 | 17/30 | Pashudhar [6 [5 16 वि |6 [5 | 5 [6 |5 [6 [5 [Madan | [भ ~ w o [15 [18/45 [Anala 7 16 (7 [6 [7 |6 [7 [6 [7 16 [7 16 | Bhaga (3 |8 8 |59 18 [8 9 18 | 21/15 [9 10 19 10/95 (109 [109 [1019 | | 19 | 23/45 | Maya [11 | 10 | 1 23/45 |. . Antaka | 12 | 11 1 11 | 12 [11 [12 Bhaga 25/0 V.Dhwa (1 [12 Vishuaka | 26/15 [2 ,1 [2 [1 [2 [1 12 7] 1 | Anala____ | 23 Madan वे डि जि डि aE EH [23 Pashudhar 24 Bhima [4 [3 [4 | (3 [4 [3 | Skanda

2 hd पा 2 ५५ a | £ पट = o Tc % 5 © (= © © a 3 क < 2 © © @ a ५ श् © or © =+ 0 | = ८0 पी ८ ~ 1 | Skanda [5 [4 [5 [थे [5 | (4 ।5 ।4 [5 | hima | 1/15 | | 2 | 2/30 Pashudhar [6 |5 16 |5 | 6 | | 5 |6 |5 |6 | |: Madan [3 [3/45 (6 [7 16 [7 [6 | (6 [7 [6 | Govind 3/45 [5/0 [Vishvaka [8 [7 [8 |7 |8 [7 [8 | | 8 |7 |v.Dhwaj [5/0 |

7/30 | Mitra 110 [9 10 10 10 [9 [10 {9 | Maya 7/30 | 8/45 | Maya [11 [10 [11 [10 [11 [10 [11 [10 | 11 115} (8 [10/0 J Antak [12 [11 12 [11] 12 [11 [12 [11 {12 | 11 | [9 111/15 [v.Dhwaj |1 [12 |} T9213 [42 [1 12 {1 1121; (2 [1 (2 [1 T2 Jv [2 [1 T2 11 12 [1 13 12 13 2 13 12 [3 [2 3 [2 [3 [2 | [4 [3 14 [3 | (3 [4 |3 [4 [3 | 15/0 (13 [16/15 [Skanda दि [4 15 [4 [5 [4 [5 [4 |5 [4 [5 | 16/15 (14 | 17/30 | Pashudhar [6 [5 16 वि |6 [5 | 5 [6 |5 [6 [5 [Madan | [भ ~ w o [15 [18/45 [Anala 7 16 (7 [6 [7 |6 [7 [6 [7 16 [7 16 | Bhaga (3 |8 8 |59 18 [8 9 18 | 21/15 [9 10 19 10/95 (109 [109 [1019 | | 19 | 23/45 | Maya [11 | 10 | 1 23/45 |. . Antaka | 12 | 11 1 11 | 12 [11 [12 Bhaga 25/0 V.Dhwa (1 [12 Vishuaka | 26/15 [2 ,1 [2 [1 [2 [1 12 7] 1 | Anala____ | 23 Madan वे डि जि डि aE EH [23 Pashudhar 24 Bhima [4 [3 [4 | (3 [4 [3 | Skanda

५६ --- ## Page 42 ` 36 Vedic Remedies in Astrology =+ | eed | =| =+ । (4 ™~ ©| =+ | ५ ८2 ¬| (५ ~ Ql =| "¬ | ८५ 2 र¬ 1 ५ द 2 | + 4 >| =| ^ Dy > | *~¬ | ०५५ [ का | व | | र से 03 MM +| =| | = Non ! ४| ~ | (+| त्न [ wd | का | का

[Agni | Shashi! | Sarpa | Aryama 5546800 10-6-40" ८ Moon or Chandra % Brihaspati --- ## Page 43 „` Astrology and Deity <= hs! oN < क ^ + | 51 cy i ~~ 3 © = 2 © त o ~ cl । =| ।9। =|, । ०/5 HE EE EE =| | =| 3, 2 छि |= = न~ ~ ति =| ml | =| Bl .= | ने हिट! त्त >= 1-1-15 >|] > [= SU EN ९१% 21|| Tene पृ बाई के दे Bd Dd है ॥१।-.1(-11-1 13||] |=] NN क {५ 28-53-20 18-53-20 18 19 14-26-40 15-33-20 16-40-0 कप न र © ™M ~ १५ 37 --- ## Page 44 38 | ~ ~ Vedic Remedies in Astrology

% Brihaspati --- ## Page 43 „` Astrology and Deity <= hs! oN < क ^ + | 51 cy i ~~ 3 © = 2 © त o ~ cl । =| ।9। =|, । ०/5 HE EE EE =| | =| 3, 2 छि |= = न~ ~ ति =| ml | =| Bl .= | ने हिट! त्त >= 1-1-15 >|] > [= SU EN ९१% 21|| Tene पृ बाई के दे Bd Dd है ॥१।-.1(-11-1 13||] |=] NN क {५ 28-53-20 18-53-20 18 19 14-26-40 15-33-20 16-40-0 कप न र © ™M ~ १५ 37 --- ## Page 44 38 | ~ ~ Vedic Remedies in Astrology

| Odd Signs | Tatwa | Deity | Degrees | Even Signs | Tatwa | Deity | ` (5 Aries [Agni [Agni [5° [Taurus | Jala |] | 10° | Aquarius | Kubera | [18° | Sagittarius | Akash | Indra 25° | Gemini | Prithvi | Kubera | 25° | Capricom | -{30 __ [Ubra [Jala [Varuna | 30 | The deities are based on the five elements of Fire (Agni), Wind (Vayu), Akash or Ether (Indra the God of Gods - the ~ Sky), Prithvi or Earth (Kubera the lord of wealth), and Jala or Fluid (Varuna the God of Water). Whereas each of the four elements of Agni (Fire), Jala (Water), Vayu (Wind) and ` Prithvi (Earth) rule the trines of Aries, Cancer, Libra and Capricom respectively, the fifth element Akash (Ether) per- . vades all signs and hence. Indra becomes the God of all these Gods. This is mentioned in the Vedic Hymn “ Sam No Indra VriddhaSravaha” wherain all the peoples from time immemorial have been taking shelter (Asraya) under Indra for their welfare and protection from evils as the Trimsamsa represents the evils that befall man.

This division determines the Karma matrilineally in- _ herited and the deities are the twelve of Vishnu, Chandra, . Marichi, Tvashta, Dhata, Suva, Ravi, Yama, Yaksha, Gandharva, Kala and Varuna repeating successively for ` all signs in this order itself । २ Khavedamsa is also called Chatvarimsamsa and is the one-fortieth division of ह a sign measuring 45' of arc. These are reckoned from Aries for odd signs and | from Libra for even signs. --- ## Page 45

5 | ६ | a ४ |, i = |. ० (5६84 log £ ® न ए £ ४ © © [य £2 2 © REAR 5 | SE (58255 ।5। € डं 8 2-158-12 {8128-2 18 [2 [8 - 9 [3 Jo 1319153 To 3 19 [3 [9 (1 Tio [4 [10 14] [ठ [430 [shiva Te [215 [1215 11215 [12 6 [1216 [817 [vams Ts 12 [8 12 15 17 18 2 15 [2 [5] उ 16.45 | Yakshesha To [3 To -15 [315 15 15 [5 15 9] 4 Tio [4 [16 Ta [10 [4 [15 [4 [1512 - ह [11 | [its [irs 115 | 5-0 [श्प 12 Te {721६121 12112112 | 13 | 9-45 | 48 .1...1/7.11. 1, 6% --- ## Page 46 2 [8 | (8 | (9 [3 |9 | (4 [10 4 | (5 11 ।5 | (6 /12 (6 12 [6 [12 (6 | 3 5 2 [8 2 [8121812 [6 [2 [8 © (3 [0 [3 [o [3 [o [3 Jo [3 19] [५ [10 [4 [15 [4 [30 7a [10a [10 [4 | ala] 5 (11 [5 [1115 [115 3 wlw|nolro |#५ | ।५ {2 [4 | ino जि लि fe [=m [= [1 ६।२६।०।७/६।७।०४०२|९।०( mE or - ASoj0415Y ut गम्य 21721 --- ## Page 47

log £ ® न ए £ ४ © © [य £2 2 © REAR 5 | SE (58255 ।5। € डं 8 2-158-12 {8128-2 18 [2 [8 - 9 [3 Jo 1319153 To 3 19 [3 [9 (1 Tio [4 [10 14] [ठ [430 [shiva Te [215 [1215 11215 [12 6 [1216 [817 [vams Ts 12 [8 12 15 17 18 2 15 [2 [5] उ 16.45 | Yakshesha To [3 To -15 [315 15 15 [5 15 9] 4 Tio [4 [16 Ta [10 [4 [15 [4 [1512 - ह [11 | [its [irs 115 | 5-0 [श्प 12 Te {721६121 12112112 | 13 | 9-45 | 48 .1...1/7.11. 1, 6% --- ## Page 46 2 [8 | (8 | (9 [3 |9 | (4 [10 4 | (5 11 ।5 | (6 /12 (6 12 [6 [12 (6 | 3 5 2 [8 2 [8121812 [6 [2 [8 © (3 [0 [3 [o [3 [o [3 Jo [3 19] [५ [10 [4 [15 [4 [30 7a [10a [10 [4 | ala] 5 (11 [5 [1115 [115 3 wlw|nolro |#५ | ।५ {2 [4 | ino जि लि fe [=m [= [1 ६।२६।०।७/६।७।०४०२|९।०( mE or - ASoj0415Y ut गम्य 21721 --- ## Page 47

Astrology and Deity 41

2.15.15 AKSHAVEDAMSAZ? (D-45):

: Table 2-19 Akshavedamsa MOVABLE GN | FIXED 54 | DUAL SIGN > = Lib; Ca Sco; Agu Sag; Pis Ear mi Ae ) Shiva 2 Vishnu | 6 | Brahma ॥ Shiva . _। 11 4 |Brahmal4 [Shiva |8 | 15/00 | 12 = [s Vishnu ० Brahma [1 | 6 Brahma | 10 Shiva | 2 7 511५2. _ 1 11 vishnu [3 | | 9 | Brahma | 1 Shiva |5 | He 11 Vishnu Brahma | 7 Brahma Shiva |8 Shiva Vishnu | 6 Brahma | 10 | 15 | Brahma | 7 Shiva 11 + Shiva | 8 Vishau | 12 10-40 | 18 | (५५. {2- 10 Shiva [2 ____ | 12-0 [15 [Brahma [7 {Shiva [11 [४५ 3 = = | | उठ [shiva _|8 | vishnu Brahma [4 | न्ना Shiva [5 [14-0 | Vishna [614-40 [11 ._ | Brahma 15-20 | Shiva | Vishnu [9 ~~ [16-40 Sh Vishnu (10 | 3 Brahma | 7 | ६8-0 __ | [4 [Shiva 18 [vishou 12 | 29 [ Shiva [5 9 |Bramma]1 19-20 30 | Vishnu | 6 _ Brahma | 10 [Shiva [2 2 Brahma | 7 __ Shiva_ | 11 vishnu 3 |2 32 | Shiva 8 Vishnu | 12 Brahma [4 [21 34 | Brahma | 10 | Shiva | 2 Vishnu _| 6 | 36 | 12 Brahma (4 [Shiva | 8 Brahma Shiva |S | 2 — 38 | Shiva | vishnu [6 | Vishnu Brahma | 7 Shiva | 40 | Brahma 5१2 [8 | ४191111५ (41 [Shiva [5 _ |vishnu [9 _ 6121१12 | 43 | 7 Shiva 11 Vishnu | 3 44 {shiva {8 | Vishnu थे. 45 [Vishnu [9 [Brahma [shiva {5 | य Akshavedamsa is the One-forty-fifth division of a sign measuring 40" of arc. These are reckoned from Aries for Movable signs, from Leo for fixed signs and from Sagittarius for Dual signs. --- ## Page 48 42 ` Vedic Remedies in Astrology herited. These are reckoned from Aries for Movable signs, from Leo for fixed signs and from Sagittarius for Dual signs Hence the deities are Brahma, Siva and Vishnu respectively for Movable, Fixed and Dual Akshavedamsa :

This division determines the Karma inherited by one’s own actions and desires from past births. Maharishi parasara gives the highest weightage to this chart in the Vimsopaka Strength scheme.

This division determines the strife etc. Although not one of the sixteen divisions given by Parasara, it finds men- tionand detailed usage in the works of Jaimini, Varshaphal etc. The deities of the eleven divisions are the eleven Rudra namely (1) Kapali (2) Pingala (3) Bhima (4) Virupaksha (5) Vilohita (6) Shasta (7) Ajapada (8) Ahirbudhanya (9) Sambhu (10) Chanda (11) Bhava. ® Shastyamsa is the one-sixtieth division of a sign measuring 30' of arc. Like the Dwadasamsa, it is always reckoned from the sign itself. ॐ Rudramsa is also called Fkadasamsa and is the one-eleventh division of a sign. It is also used to determine strife, affliction by enemies and war. --- ## Page 49 ` ` Astrology and Deity 43 || - 0 | 8-0 | 1-0 1-30 Dandayudh | Kalagani | (5 /6 17 [8 ,9 110 111 1 Danshtrakar | 6-0 | (6 [7 8 |9 / 10 | 11 | 12 |Sheetal [6-30 | कि ५ प — = [=] 0 kK") cl Oo [4] c 2 |> |§ ५ ~ @ < | £| | 915 <€।75 = 3 ॐ ,5|* |S[3l9E v ठ | ~| ८ |} छ — == (On (I n= = >| — 1 331 4.8.111" _ ० ० HAS ol लिन [BE |e (= folios | 71107010 वि 0971 "21011708 35९0011 4 15 (6 |7 [8 9 | (8 [9 | (8 9 10 | 11 | 121 [2 | (9 10 | 11 | 121 [2 [3 |

Raksho Gana Kulaghna | Garla | | 6 | Kinnar

Kuber --- ## Page 50 5 ।6 [7 [8 [9 | 10 [11 | 12 1 [2 [3 [4 8-30 19 (8 [9 । 10 | 11 | 12 |} [2 [3 [4 [5 [6 [Mukhya (8 ।9 । 10 |11 | 12 /1 2 [3 4 [5 [6 [7 CITE EE 30 1 [2 13 [4 15 16 17 [8 ।9 | TTT 30 [SY |) | >| | 1 2 13 [4 |> | (8 [9 | 12-0 ११११११११ 30 (26 |Ardra [1 12 (4 5 [6 | (9 । 10, 11 | 12 [Maya | (2 13 4 |5 [6 [7 [8 Jo [10 | 11 (12 1 1330 3 ।4 | (8 (9 10 11 2.1 [2 [= : FREE 30 | 10 | | 7 2 13 [4 | 15-0 Mritya (2 [3 |4 [5 [6 | कि ahi 7 | 3 5 Ww © म णा ww ww ww Ww(N * | = ~J [=] ।- La = ~l N= [=] - kf ~ Mo ॥~ | Nf] +~ |. | कह ५५ No i 2 4 4 1501०45 111 SAPAWTY 21224 --- ## Page 51 1 {21314 {5 {6 [7 [8 19 [10] Digambar [18-0 | 1 [2 [3 [45 16 [7 [8 [9 [10] 1 12 [3 Ja 15 16 [7 18 |9 | 2 [3 [4 [5 6 [7 8 Jo । 10. 1112, [40 [viPradma 13 [4 |5 हि 1718 [9 1111 11211 [2 [Komal _।20-0 | [4 [5 हि 7 [8 Jo [10 | 11|12|}\ [2 [3 । | 5 [6 [7 [8 19 (1011 |1\2:|;: [2 13 (4 | (6 [7 [8 [9 (10 |1\|1\2|\ 2 [3 ,4 +> | [42 [८5-12-11 121 [2 [3 4 5 [6 | | 45 | KalRupa [8 | 10 | 11 | 12 2 13 4 [5 (6 | | 9 । 10 | 11 । 12 3 5 [6 17 [8 | (10 [11 {121 2 (3 [4 [5 |6 7 (8 [9 | 48 | 3 [a5 [6 [7 [8 |9 | [49 [Danshtrakar [1211 [2 {3 [4 56 [7 |8 [9 {10/11 [50 [Indumukha 1 2 [3 14 Is [6 {7 [8 |9 | 10 11 | 12 Maya | (4 15 |6 |7 18 [9 | Eee ei (5 14 ,5 /6 [7 18 |9 10 11 , 12, + (6 [4 |5 |6 17 [8 [9 10, 11 (12 |; 55 | 3014002 17 5 |6 [7 8 Jo [10 , 11 12|1\ 12 13 [56 [Ashubha ~~ [8 5 [6 |> [8 Jo [10 (11 | 12 1 [2 [3 |Rakshogan [28-0 | |o ।6 |7 ।8 [9 10 | 11 ]12[1 [2 |3 14 58 | Sudhapaya [1016 |7 [8 |9 | 1 12 4 | 59 | Bhraiman | 11 (8 |9 | 3 | 5 | | 60 | [8 [o | 10 | 11 |12|\ 12 [3 (4 [5 | (1140 1/1... पक --- ## Page 52 46 Vedic Remedies in Astrology

Maharishi Jaimini has expressed similar views as Maharishi Parasara about the deities, but with a slight difference as he does not advise the worship of Brahma. In fact, there is only one shrine of Brahma in In- dia at Pushkar, Rajasthan. The reasons for this 15 ` the marriage of Brahma with His own daughter Goddess Saraswati that resulted in the anger of Lord Shiva. Even today there are many women who are, or have been sexu- ally tormented by their own relatives and parents. They should be advised to worship Lord Shiva with the Mritunjaya Mantra. Table 2.6 gives his recommenda- tions.

न - [न _ [प [व [र (म ८ —

Harihara, the author of Prasna Marga and later day authors of the Middle Ages have given a host of deities for various combinations and placement of the planets mak- ing the study very cumbersome (and rather Rajasik). They belong to the middle ages where Vedic Worship was al- most forgotten and the Gandharva, Yaksha as well as vari- ous forms of Black magic rituals prevailed till the eme:- “gence of Adi Sankara and the other teachers of the Bhakti Marga (Bhakti School which resulted in the revival of Hin- duism). Harihara has given the methods for determining the use or rather misuse and torment by Black Magic, spir- its, ghouls and various symptoms and diseases. Some of the remedial measures suggested are quite effective and fi- --- ## Page 53

Astrology and Deity 47

all signs except 17 6 2" Drekkana of Dual | Lord Shiva® sighs ~ 1" Drekkana of Dual signs Kartikeya? तता [Burge ------------------ Weak Kali

Chamundi, Bhadrakali and other female Martian deities _Sri Vishny Avatar Sri Krishna Gdd signs Even Signs Maha Vishnu or Narayana® Annapoormaswari _Signs of Rajasik planets Signs of Tamasik planets TAllsigns | [९५ __ [65905 = | [Kets TAusigns -_-------------- ३ [Prasna Marga Chapter 13 Stanza 37 & 38 ] Tiviajwa rabhicharad iShantidam Havanam Malam (.) Mritunjayakhya Mantrena Naiva Kevalamayusham () Tivrajware TivratarabhichareSonmodake Dahagade Cha Mohe () Tanoti Shantim Nachirena HomahSanjeevanaschastaSahasraSamkhya(.) Mritunjaya Manira (as tanght by Maharishi Vashistha in the Rig Veda VIL59) is also called the Sanjeevani Mantra (that was taughtb ॥ Sukracharya (0 Kaccha ६ {< son of Brihaspali). It notonly : gives ralief from intermittent and all evil influences from spirits etc, but it can also conquer . (premature) death. Black Magic, seemingly incura ble diseases, mental diseases, epilepsy ek, can all be overcome by the Japa (repetition) of the Mritunjaya Mantra 8000 Goves (normally, this figure is covered in 40 days by reciting the Mantra 108 times in the morning and evening). ॐ Referstothe12 J yotirlinga's of Lord Shiva. The Jyotitlin भ 1efers to the Sun signs as givenin Table 2.23. One basis of fixation is the princi 7 le of exaltation of the planets. For example Rameshwar causes the exaltation of the Sun and thisis Aries, while Somanath causes the exal- tation of the Moonand this Tacrus. Trvambakeshwar causes of exaltation of Venus and is the deity of the Mritunjaya mantra and this is in Pisces ruling hospitals, nursing, cure ele. ॐ Flder son of Lord Shiva also called Subramanya and referred to as the God of ane Fing a NA ear. He rides Lhe peacock, the sy mbol of victory among the Pancha Pakshi (Five Birds). > Younger son of Lord Shiva and the Lord of Education, Knowledge (that leads to Moksha) as well us obstacles (as per the name Vi; fheswara). Also see footmate ॐ Strong and Weak Moon refers to the Waxing and waning phases of the Moon, although astro- logically, the Maon is strony, from Sukla Paksha Ekadasi to Krysna Paksha Panchami ie. from 120° to 240° from the Sun. Durga is worshipped in Her kn forms during the Sukla Paksha whereas Kali is worshipped as the Dasa Maha Vidya (again ten forms) during the Krusna -Paksha. These ten forms are with reference to the nine planetsand 1.2 fro. The Das Maha Vidya are Sri Matan, ५1 {Sun}, Sri Bhuvaneswari (Moon), Sri Bagalamukhi (Mars), SriTrip arasundari (Mercury), Sri Ugra Tara (Jupiter), Sri Kamalatmika (Venus), Sri Kali (Saturn), Sri Chinnamasta (Rahu), ठु Dheomavati (Ketu} and Sri Bhairavi ही agna). Refer to table 2.1 that gives the Vishnu Avatar. Thus, He ity y can be easily chosen on the basis of the dispositor of Mercury. Care should be taken in the four fixed signs as in the first two Drekkana of these signs, Mercury represents Sri Krishna in addition to its placement in Cancer. Thus, Mercury in the third Drekkana of Leo (Sun-Lord) alone will rey presente Ram; in the third Drekkana of Searp io (Ketu-Lord) it will represent Sri Matsya; and in the third Drekkana of Aquarius {Lord-Rahu) Sri Varaha, However, this theory of dispositor suggested by Harihara is to be applied if no planet conjoins or aspects Mercury. lf planets conjoin or aspect Mercury, then the strongest of them willindicate the Avatar. ॐ Bei ng Rajas by nature Mercury causes one to differentiate and hence the native worships Vishnu in His incarnations, whereas Jupiter is very Satwik by nature and does not like differentialion. Hence he worships Vishnu in His undifferentialed form ie. as Parambrahima like Satya Narayana. = The (पं planetsare the Sun (I ev), Moon (Cancer) and Jupiter (Pisces & Sagittarius). The Rajas Planets are Mercury (Virga & Gemini) and Venus (Taurus & Libra). The Tamas Planets are Mars (Aries & Scorpic) and Saturn {Capricorn & A duarius), This should NOT BEMISTAKEN with the natural nature of the signs on the basis of Movable (Rajas), Fixed (Tamas) and Dual (Satwik). ॐ Sarpa refers to the various Snakes as given in Table 2.5 Column 5. . # Gri Narada has advised the recilation of the twelve names of Sri Ganapati (for the 12 signs starting from Aries). Thescare(1) Vakratunda (2) Ekadania (3) Ksusnapingakshya (4) Gajavakra (5) Lambodara (6) Vikata (7) Vighnaraja (8) Dhoomravarna (9) Bhala-Chandra (10) Vinayaka (11) Gajupali (12) Gajananna. 3 & --- ## Page 54 48 Vedic Remedies in Astrology nally he stdtes® the penultimate remedy for all these evils is the Mritunjaya mantra. This only proves the point that one should stick to the best and most effective satwik rem- edies. The general views of Harihara on determination of the deities from the Chart are in Table 2.22. | पमो | Exaltation = Vishwanath Exaltation | Bhimashankar Kedarnath Table 2-23: Jyotirlinga Rameshwar | Rama's Lord or Whose Lord Rama Sun) Is: Sun Exaltation | Somanath | Krishna's tard or Whose Lord Krishna is: Moon Exaitation The Lord of the snakes (Naga) Rahu | Sagitlarius Om the Beejamantra responsible for | Capricorn | Jupiter's Exaltation Exaltation__ |~ | Lord of the Tapaswi in the jungle/ remote areas, Virgo | Mallikarjuna |

Tiviajwa rabhicharad iShantidam Havanam Malam (.) Mritunjayakhya Mantrena Naiva Kevalamayusham () Tivrajware TivratarabhichareSonmodake Dahagade Cha Mohe () Tanoti Shantim Nachirena HomahSanjeevanaschastaSahasraSamkhya(.) Mritunjaya Manira (as tanght by Maharishi Vashistha in the Rig Veda VIL59) is also called the Sanjeevani Mantra (that was taughtb ॥ Sukracharya (0 Kaccha ६ {< son of Brihaspali). It notonly : gives ralief from intermittent and all evil influences from spirits etc, but it can also conquer . (premature) death. Black Magic, seemingly incura ble diseases, mental diseases, epilepsy ek, can all be overcome by the Japa (repetition) of the Mritunjaya Mantra 8000 Goves (normally, this figure is covered in 40 days by reciting the Mantra 108 times in the morning and evening). ॐ Referstothe12 J yotirlinga's of Lord Shiva. The Jyotitlin भ 1efers to the Sun signs as givenin Table 2.23. One basis of fixation is the princi 7 le of exaltation of the planets. For example Rameshwar causes the exaltation of the Sun and thisis Aries, while Somanath causes the exal- tation of the Moonand this Tacrus. Trvambakeshwar causes of exaltation of Venus and is the deity of the Mritunjaya mantra and this is in Pisces ruling hospitals, nursing, cure ele. ॐ Flder son of Lord Shiva also called Subramanya and referred to as the God of ane Fing a NA ear. He rides Lhe peacock, the sy mbol of victory among the Pancha Pakshi (Five Birds). > Younger son of Lord Shiva and the Lord of Education, Knowledge (that leads to Moksha) as well us obstacles (as per the name Vi; fheswara). Also see footmate ॐ Strong and Weak Moon refers to the Waxing and waning phases of the Moon, although astro- logically, the Maon is strony, from Sukla Paksha Ekadasi to Krysna Paksha Panchami ie. from 120° to 240° from the Sun. Durga is worshipped in Her kn forms during the Sukla Paksha whereas Kali is worshipped as the Dasa Maha Vidya (again ten forms) during the Krusna -Paksha. These ten forms are with reference to the nine planetsand 1.2 fro. The Das Maha Vidya are Sri Matan, ५1 {Sun}, Sri Bhuvaneswari (Moon), Sri Bagalamukhi (Mars), SriTrip arasundari (Mercury), Sri Ugra Tara (Jupiter), Sri Kamalatmika (Venus), Sri Kali (Saturn), Sri Chinnamasta (Rahu), ठु Dheomavati (Ketu} and Sri Bhairavi ही agna). Refer to table 2.1 that gives the Vishnu Avatar. Thus, He ity y can be easily chosen on the basis of the dispositor of Mercury. Care should be taken in the four fixed signs as in the first two Drekkana of these signs, Mercury represents Sri Krishna in addition to its placement in Cancer. Thus, Mercury in the third Drekkana of Leo (Sun-Lord) alone will rey presente Ram; in the third Drekkana of Searp io (Ketu-Lord) it will represent Sri Matsya; and in the third Drekkana of Aquarius {Lord-Rahu) Sri Varaha, However, this theory of dispositor suggested by Harihara is to be applied if no planet conjoins or aspects Mercury. lf planets conjoin or aspect Mercury, then the strongest of them willindicate the Avatar. ॐ Bei ng Rajas by nature Mercury causes one to differentiate and hence the native worships Vishnu in His incarnations, whereas Jupiter is very Satwik by nature and does not like differentialion. Hence he worships Vishnu in His undifferentialed form ie. as Parambrahima like Satya Narayana. = The (पं planetsare the Sun (I ev), Moon (Cancer) and Jupiter (Pisces & Sagittarius). The Rajas Planets are Mercury (Virga & Gemini) and Venus (Taurus & Libra). The Tamas Planets are Mars (Aries & Scorpic) and Saturn {Capricorn & A duarius), This should NOT BEMISTAKEN with the natural nature of the signs on the basis of Movable (Rajas), Fixed (Tamas) and Dual (Satwik). ॐ Sarpa refers to the various Snakes as given in Table 2.5 Column 5. . # Gri Narada has advised the recilation of the twelve names of Sri Ganapati (for the 12 signs starting from Aries). Thescare(1) Vakratunda (2) Ekadania (3) Ksusnapingakshya (4) Gajavakra (5) Lambodara (6) Vikata (7) Vighnaraja (8) Dhoomravarna (9) Bhala-Chandra (10) Vinayaka (11) Gajupali (12) Gajananna. 3 & --- ## Page 54 48 Vedic Remedies in Astrology nally he stdtes® the penultimate remedy for all these evils is the Mritunjaya mantra. This only proves the point that one should stick to the best and most effective satwik rem- edies. The general views of Harihara on determination of the deities from the Chart are in Table 2.22. | पमो | Exaltation = Vishwanath Exaltation | Bhimashankar Kedarnath Table 2-23: Jyotirlinga Rameshwar | Rama's Lord or Whose Lord Rama Sun) Is: Sun Exaltation | Somanath | Krishna's tard or Whose Lord Krishna is: Moon Exaitation The Lord of the snakes (Naga) Rahu | Sagitlarius Om the Beejamantra responsible for | Capricorn | Jupiter's Exaltation Exaltation__ |~ | Lord of the Tapaswi in the jungle/ remote areas, Virgo | Mallikarjuna |

Scorpio Cancer on r | Exaltat 24 ILLUSTRATION Chart 2-1:Male Born on 7* August 1963, 9:15. PM IST; 21N28, 84E01, India Determine the constellation occupied by the ascendant “and other planets as well as the deities of the divisions oc- cupied by the planets.

RASH

ग Refer to Maharishi Jaimini's Upadesa Sutra for calculations --- ## Page 55 Table 2-24: Longitude of Lagna and Planets, Constellation and Lords of Shastyamsa Planet Position Star-Pada Chara Date of Birth August 7, 1963 ही : Karaka | [24078 | 14 Pi 0455.90" | U.Bhad. 4 | | Time of Birth_ 9:15:00 pm BK 21 Cn 04'32,78" | Aslesha 2 19 Aq 59'04.44" | Satabhisaj 4 32. BK 5 Sravana [Pusyad4 | | Rahu | 16 Pi 53'03.17" 23:20:39" 13Pi39'5589" [UBhad.4 | | ~~} EE EE 13 5८ 19'18.17" [Anuradha3 | | =} 0000] Ghati Lag | 2 Sc 38'03.17" | Visakha 4 |... (140... 67 --- ## Page 56 50 Vedic Remedies in Astrology

Table 2-25: Chara" Karaka Chakra

- (^ Table 2-26 Deities of Navamsa on the Basis of Nature of signs {Refer Table 2.10) ! ८५५ _ | [Fixed | [ड [कप्य | Deva | Rakshas | Rakshas | [व [Raksha | [Shiva [Brahma | Vishnu | Shiva | Shiva | Shiva | Shiva | Vishnu | Shiva | Shiva | Table 2-27: Deities of the Dasamsa ` (Refer Table 2.11) | Sun | NW — | ० | n | Moon] [Mars | ™ Jp [Ven [इ ma | Kuber छापा Vayu | Agni uth | Norh West NW SE Si Y 5 [० ` 1 Similarly, the deities of the other divisional ¢harts can be determined.. Chart 2-2:Ramakrishna Paramhamsa Born an 18th Feb- ruary 1836 at 6:23" AM; 22N53, 87E44 ` Jup | ५ | ५५ [man CHART 2-2 Ramakrishna RAS!

Let us determine the deity on the basis of the nature of the person (Vedic Method). The nature is seen from the trines to the ascendant. All trines are occupied and the ascen- dant with three planets is stronger than the others. Among the three planets in the ascendant, the strongest is the Moon with the highest longitude. Hence the Moon determines --- ## Page 57

the deity. The Moon is almost new and very weak in Paksha Bala. Hence between Kali and Durga, it will represent Kali and the Dasa-Mahavidya. The Moon is also in a Saturnine sign and is also having Saturn exalted in trines to it. Ramakrishna Paramhamsa worshipped the Divine Mother in the form of Kali Mata and is known for the populariza- tion of Her worship and the spread of Dasa Mahavidya throughout the globe. He is considered as a reincarnation of the Divine Mother herself by many devotees. It is note- worthy that the Mantrapada (A5) is in Libra conjoined Saturn (Kali). . Chart 2-3: Swami Vivekananda Male Born on 12 Jan CHART 2-3 Vivekananda RASI

Let us determine the natural deity of the person as per the Vedic method. The nature is seen from the trines to the ascendant. This is Sagittarius with Mars and Sun in trines in Sagittarius and Aries respectively. Both signs are equally occupied and hence equally strong. The Sun has a higher longitude in the sign than mars and it is also the Chara- Atmakaraka (Temporal AK) and hence is stronger than Mars. The Sun in all signs represents Lord Shiva except the 1५ & 2" Drekkana of Dual signs. Here it is in the third Drekkana of Sagittarius and clearly represents Lord Shiva. Thus, the deity as per the nature of Swamiji is Lord Shiva. It is recorded that his parents had performed severe aus- --- ## Page 58 52 ~ ` Vedic Remedies in Astrology terities at Kashi Vishwanath (Jyotirlinga) for begetting a son. After the austerities were completed, his mother saw a vision in which she saw the son. Readers may note that his Guru Ramakrishna Paramhamsa has named him very aptly “Vivekananda” or “He who brings joy to the Sun God”. Remedial Measures will be successful if this inherent nature of the individual is always kept in the perspective. Chart 2-4:Chart 5 Srila Prabhupada Male born on 19 September 1896 at Calcutta at 15:24. LMT 22N32 88E22

Srila Prabhupada RASI

In chart 2-4, the ascendant is a fiery Jupiterian sign Sagittarius with three planets in the ninth house in trine. Among the three, Jupiter is closely conjunct Mokshkarak Ketu and the Sun has the highestlongitude. Thus, although the Sun would justify being the strongest, by virtue of also being the Lagna Lord, and also by the Veeryakoti Prin- ciple, Jupiter will dominate and the native will be an ar- dent devotee of Lord Mahavishnu. It is important to note the strongly Satwik nature of the planets involved and this suggests an undifferentiated view of the Lord. True to the - nature of the Jupiter and the Sun, he worshipped Lord ` Jagannath (Sri Krishna in His Parambrahma Vesa as the teacher of the Universe as worshipped in Puri, India). Thus, his worship was natural to his Satwa Guna and showed up very early in his life. It is noteworthy that the Mantrapada (4.5) is in Virgo conjoined exalted Mercury (Sri Krishna) and debilitated Venus (Sri Radhika). --- ## Page 59

Astakavarga Illustration to Chart 2-5:Standard Nativity (See Chart 2-1 for details) तु

CHART 2-5 Astakavarga RASI Male 7 Aug 1963 9:15 PM IST Sambalpur India The first thing to check is the signs having low SAV score, especially those below 25. Here, three signs Virgo, Scorpio and Aquarius have scores below 25. Both Virgo and Aquarius have a score of 20 points and also house the ninth and fifth lords which are very crucial for the finan- cial strength and well being of the chart. Under Table 2.4, the row for score 20 reads as follows: — पिरि प णण 20] Dull-witted/ loss of memory or intelligence | Goddess Saraswati should be worshipped. Thus the native should worship Goddess Saraswati to ward off the negative effects of loss of memory etc. The ninth house of Father & fortune has a low score of 24 points. The relevant row of Table 2.4 reads as follows: Since the donation of Cows should be only done to a pious Brahmin who can care for them, it is better to look for another way out. The Moon rules cows and so also rice. Thus donation of rice will also be beneficial. Alternatively, milk & water can be offered to Lord Shiva. In this manner the intelligent Jyotish should prescribe practical remedial measures. ~ क्व SAT --- ## Page 60 HII नम | Chapter III ASTROLOGICAL PRINCIPLES

The determination of the deity is to be done in two stages. First is to determine the guiding deities of the na- tive. These are the three of ¥sta Devata or the deity guiding the individual soul towards emancipation, the Kula Devata or the deity guiding him in the present life to improve his life and surroundings and the Teacher or Guru Devata. These three form the primary tripod of his life and are akin to the Sun (Natural significator of Soul), Moon (Natural Significator of Mind and the well being in this life) and Jupiter (Natural significator of Paka Lagna or the sign oc- cupied by Lagna Lord, and Guru) respectively. Second is to determine the immediate problem and offer a solution. The second would be a short-term remedy that is really not going to help much in spiritual development, but is vital to establishing faith in God. All Jyotish are advised to tread ` very carefully in this region of remedial measures as in our anxiety to help we should not end up doing bad karma. 3.1.1. Ista DeEvATA & DHARMA DEVATA In the previous chapters we have discussed the deter- ` mination of the deities on the basis of signs and planets. . Maharishi [काणा advises us to examine the ninth & twelfth houses from Karakamsa? to determine the worship. ४ Jaimini’s Upadesa Sutra 2-1-68 र Sign occupied by the Atmakaraka in the Navamsa --- ## Page 61

र Sign occupied by the Atmakaraka in the Navamsa --- ## Page 61

: The ninth house rules temples and the Dharma whereas the twelfth house rules Moksha or emancipation. As far as . the Atmakaraka is concerned, its main objective is to attain Moksha and hence, the Ista Devata of a person is seen . "from the strongest planetary influence on the twelfth house from Karakamsa. Similarly, the Dharma Devata is seen from strongest planetary influence on the ninth house from Karakamsa. Unlike the Ista devata, the Dharma Devata helps a person to attain the ideals and objectives that the soul wishes to achieve in this life. * The strongest planetary influence is determined as fol- lows: व The strongest planetary influence on the twelfth house is seen from the placement of planets in the twelfth house. If more than one planet is placed therein, then their placement in Exaltation/own house etc should be considered failing which, their degrees in the Rasi Chart is to be taken and the one with the highest degrees is to be declared the strongest. : If there are none in the twelfth house, then the planetaly aspects on the second house should be ` determined. In this case, the aspect of the signs alone are to be used as the deities do not exist in a “human body”. If more than one planet aspects, then the strongest amongst them should be considered. If there are no planets aspecting the twelfth house, then the lord of the house should be considered. Maharishi Jaimini adds “Kaitou Kaivalyam™? or if Ketu the Mokshkaraka is placed in these house (i.e. the 9" or 12५ from Karakamsa in the Navamsa Chart), then the native aspires for final emancipation. Further, if these signs* are Pisces or Cancer (the natural Moksh trines), this desire for 2 Jaimini’s Upadesa Sutra (Stanza 2-1-69) ¢ Jaimini uses the terms “Kriya” and “Chapa” to refer to the signs, which by । the Katapayadi Varga are Pisces and Cancer. Some translators have pre- "ferred “Aries” and “Sagittarius” as the direct translation of the terms in- stead. (Stanza 2-1-70) --- ## Page 62 56 ` Vedic Remedies in Astrology emancipation will be marked. While giving the list of dei- ties for planets from the Sun to Ketu, Jaimini adds “Paparshe Mande Kshudradevatasu” (Stanza: 2-1-80). Thus, if Saturn ` is ill placed in a malefic sign in the 9* or 12* house from the - Karakamsa, the native worships devils and indulges in other forbidden acts like black magic. Venus similarly placed also makes the native indulge in black magic involving the act of sexual intercourse etc. However, readers are advised not , to jump to conclusions prematurely and to ascertain the nature of the ascendant as per the teachings of the Bhagavat Gita®. The faith of a person is the clue to his nature and we are already aware of the fact that the nature of a person is seen from the trines to the Ascendant or AK, the latter speaking more about his inner nature in the spiritual sense. Thus, the ninth house from the AK is the most vital deity - who guides him in achieving the objectives of his nature, This is the Dharma Devata. Yet, the real achievement is to lose the “self” identity of the soul so that in can merge in the consciousness of Godhead. This is self-undoing and is seen from the 12* house. From the Karakamsa, the deity seen in the 12५ house becomes the Ista Devata as it guides the soul towards the high spiritual ideal. This deity should be favorable; else, the entire voyage of this life could be- . .- ‘come meaningless. “Trikone Papadwaye Mantrika” (Stanza: 2-1-83) implies that if two malefics are in trines to Karakamsa the person is a Mantrika® ie. he has powers of invoking the supernatural by magical formulae. “Papadruste ""Nigrahaka” or if malefics also aspect these two malefics in trines (or if at least three malefics are in trines), then he has the powers to call spirits, grahas’ etc by using magical $ Srimad Bhagavat Gita Chapter 17 Sloka’s 2-4. The faith of the embodied . beings born of their own nature is threefold- born of Sattwa (Truth), Rajas . (Passion) and Tamas (Ignorance). (Gita 17-2) The faith of all beings is in accordance with their nature (Lagna / Moon). The person is made up of faith as the dominant factor. He is verily what his faith is. (Gita 17-3) Those having Satwa Guna worship the Gods, Rajas Guna the Demi-Gods, and Tamas Guna worship Pretam (spirits, ghouls) or the Sapta-Matrika (Shakti cult). (Gita 17-4) $ A person adept at Mantra Shastra. --- ## Page 63

formulae. The maximum number of malefic planets influ- encing the trines can be four and give this a 100% strength. This will decrease to 75% for three, 50% for two and so on. The knowledge grades can be Tantrika, Yantrika and Mantrika respectively. Tantrika is derived from the word “Tan” or Body and “Tra” to control. Thus, a Tantrika can control the bodies of others or influence them in a positive or negative manner. Yantrika is one who uses implements and drawings (Yantra). Mantrika is one who uses Mantra alone. These are also grades of knowledge of the occult. The point to be noted is that this only gives the extent of occult and spiritual knowledge. How is this knowledge go- ing to be used is the next question. “Subha Druste Anugrahakah” i.e if benefic’s aspect, then this knowledge shall be used for the welfare of all. It should be carefully noted that the benefic in question is not in direct conflict with a malefic involved in the yoga. Maharishi Jaimini ex- plains this point with some examples. If Jupiter and Rahu conjoin/ aspect the trine, then the native indulges in Black Magic or maybe subject to the same. Dental problems show up in the latter case as a symptom. If Saturn and Jupiter conjoin/ aspect the trine, then both the native and the en- emy are destroyed i.e. the native could die fighting for an- ‘other person or self, -3.1.2. PaLaN KARTA The Palana Devata is signified by the Moon and is re- sponsible for guiding the activities of the members of the family in their material life. He looks after the individual during the present birth. Jaimini spells out the method of locating this in the stanza “Amatya dase chaivam” or the Palana Devata is seen from the sixth from the Amatya Karaka’ (in the Navamsa) in the same basis as the twelfth from the AK. It is for this reason that the profession of the parent was advised to the natives in days of yore. How- ever, in modern day charts, this feature may not be present and the Palana Devata will have to be determined for each र? Amatya Karaka is the second among the Chara Karaka in the eight planet scheme, --- ## Page 64 58 Vedic Remedies in Astrology _ chart. This deity should be favorable for good livelihood ~ and financial success. The strength of planetary influence on the concerned house should be seen on the basis or rules ` given under 3.1.1 3.1.3. Guru DevaTta The Navamsa sign of the Bhratrikaraka® itself is seen for the Guru Devata or Guide & teacher of the chart. The Guru(s) are indicated by the Bhratrikaraka as well as the planets conjoining and aspecting it in the Navamsa. These Guru(s) would be teaching Dharma, Jyotisha etc. i.e. Veda or Vedanga. (पाप (5) in other areas are to be seen in other divisional charts. The strength of planetary influence on . the concerned house should be seen on the basis or rules given under 3.1.1. 3.14, Kura Devata Kula refers to the family and hence Kula Devata re- fers to the family deity. The second house rules the family and the Vimsamsa (D-20) Chart is used to determine -Upasana or worship. Thus, we can infer that the family deity is seen from the second house in the Vimsamsa ` (0-20 Chart. Thus, this can also be useful for birth chart rectification in the case of babies as other events of their life would not be available. The strength of planetary influ- ence on the concerned house should be seen on the basis or rules given under 3.1.1. 3.1.5. GRAMA DEVATA & STHANA DEVATA: Grama means village and hence Grama Devata refers to the Guardian or presiding deity of the village. The Kula Devata is also referred to as the Grama Deuvata or the deity of the village/town to which the person belongs. However, these can be different if the fourth house does not have any association with the second house. This normally happens in a small village, which constitutes a Kula (Family). However, in large cities and towns, the Sthana Devata is definitely different (Sthana refers to large place in this 8 Third in the hierarchy after Atmakaraka & Amatyakaraka, --- ## Page 65

context) and is seen in the strongest planetary influence on the fourth house in the Vimsamsa Chart. The strength of planetary influence on the concerned house should be seen on the basis or rules given under 3.1.1.

There are many traditional tools for timing the event of meeting the Guru or spiritual guide. These include: The aspect of transit Jupiter (by Rasi dristi or sign sight) on the Mantrapada (A5) brings one into contact with the Guru and the receipt of Guru Mantra can take place if other factors favour. The transit of Ketu in trines to the Arudha Lagna (AL) makes a person spiritually inclined and renunciation can ` occur. The Drig dasa of the Arudha Lagna surely gives spirituality and can make a person join a spiritual/ religious order. The Vimsottari dasa of planets influencing the fifth and ninth houses gives the knowledge of Mantra and Guru. This is also to be seen in the Vimsamsa (D-20) Chart. ILLUSTRATION Chart 3.1 Male born on 7* August 1963 at Sambalpur, India at 9:15PM IST Determine the Devata for the Stan- --- ## Page 66 60 | Vedic Remedies in Astrology We need to see the Navamsa and Vimsamsa charts only for this purpose after determining the Chara Karaka from the Rasi (D-1) Chart. In Chart 3-1, the Atmakaraka is Saturn, Amatyakaraka is Jupiter and Bhratrikaraka is Sun. | CHART 3-1 NAVAMSA

The Atmakaraka Saturn is placed in Virgo in the Navamsa Chart. This is called the Karakamsa. The twelfth house from this sign is to be examined for Bandana (bondage/re-birth) & Moksha (emancipation). This is Leo and Mercury is placed in this sign in Vargottama. Mercury indicates Vishnu and (as per Harihara®) being in the second Drekkana will indicate Sri Krishna specifically. Since the signs are fiery, the direction indicated is the east (Sri Jagannath at Puri in East India). Thus, the Ista Devata is Sri Jagannath Krishna, `

The Amatyakaraka Jupiter is placed in Aquarius Navamsa. The sixth house from this sign is Cancer. No planets are in Cancer, but being a movable sign this is aspected by the fixed signs Taurus (with Mars & Rahu indicating Chamunda Devi), Aquarius (with Jupiter indicating Guru/Samba Siva) and Scorpio (with Venus & Ketu indicating Lakshmi & Ganesha). The native can „ * Chapter 2; Para 2.3 and table 2.22 --- ## Page 67 ` Astrological Principles ` ` 61 worship any of these deities although the strongest is the Mars & Rahu combination indicating Chamunda Devi.

The Guru or teacher is seen from the Devata Karaka Sun which is placed alone in Capricorn in Navamsa. Thus, the Guru can be a worshipper of Shiva or one named after Shiva/Surya the Sun God. The native was given the Diksha of the Gayatri mantra by Late Sri Kasinath Rath (Kasinath refers to the Jyotirlinga Vishvanath (Shiva) as the Lord of Kasi/Benaras). The picture of these Devata and Guru becomes clearer if we examine the Vimsamsa (D-20 . Chart). CHART 3-1 NAVAMSA In the Vimsamsa, the Atmakaraka is also placed in Virgo and Mercury indicating the Ista Devata in the Navamsa is again placed in the Leo (12% from AK) and in the fourth house from Vimsamsa Lagna to show the Sthana/ Grama Devata. The native belongs to a Brahmin family of Puri and hence the reading about Jagannath Krishna as the Sthana Devata and Ista Devata is accurate and crystal - clear now. The Sun is the Lord of the 4५ house but is placed in the second house (family) and indicates the Kula Devata as Shiva. The Kula Devata of the native (belonging to Atri Gotra) is Lord Somanath (Jyotirlinga) or Shiva and since ‘the sun also indicated the Guru, it is from his Diksha Guru --- ## Page 68 62 ` ©. Vedic Remedies in Astrology Guru Devata) in the form of knowledge etc. 3.2. ASTADALA PADMA (EIGHT PETAL LOTUS) The Astadala Padma (Eight petal lotus) is the founda- tion of Hindu philosophy. it is based on the Kalachakra or "the wheel of time, which is composed of eight spokes and. has the 28 constellations distributed in these spokes. Each of these spokes is in one of the cardinal or intermediate “directions and is reckoned starting from the east and mov- ing in the clockwise direction. Based on this we have the Chatusdalapadma (Four petal lotus) and the Asta- mangalam Kriya which is the ritual of worshipping the deities and the Graha's inside the horoscope before con- ducting a Prasna (Horary chart) or studying a horoscope. . Fig 4.1 gives a schematic representation of the principle of the eight-petal Lotus. The Eight Petal Lotus with the eight planets holds the eight Chara Karaka (Temporal Significators). The Sun is worshipped in the eastern direction and rules the Pratipada ` , व्रात Navami Tithi in both the bright and dark halves of the Aunar month. Thus, an idol or picture or any symbol of the Ista Devata should be placed in the eastern direction. The best time to worship any deity is on the day (week- day) ruled by the lord of the sign wherein the planet repre- senting the deity is placed in the natal chart. For example, if a person has Rahu in the fourth house in Gemini, then Durga Devi, the deity of Rahu is to be worshipped on a Wednesday during Rahu Kalam. This is the best time of ‘propitiation as given in the Agastya Nadi. If the Tithi is also ruled by Rahu like Astami(8) or Amavasya (K-15), then the results are sure to accrue at an early date. The deities are also seen from the Kalachakra, The evils ण The eight Yama of the day are reckoned in the clockwise direction starting from the planet ruling the day. Similarly, the eight Yama of the night are reckoned from the fifth from the planet ruling the day. For example, Rahu Kalam in the daytime or the Yama of Rahu (NE) on a Wednesday will be the fifth as the same is computed {rom Mercury (SW) in the Kalachakra. Starting from 6.00AM (or Sunrise), this time is from 12:00 Noon to 1:30" PM. --- ## Page 69

~ Figure 3-1Schematic representation of Kalachakra KAI ACHAKRA ©) ४०८ Sign: Aries Taurus; Planet: SUN छाए: निधि E Thhi: Pratipad {1) Navami (8); Animal Garuda {King of Birds) yoni; ए Sign C.eminl imal Garuda (King )Yani.uhwaya (Flag) Planet cam SE - Ma Sign: Virga; पि? Planel: Mars, {guna Paksha Ti. Trea CO) 15) 1५ Yon Yeyess Ekadasi (11) pri Hare Animal:Cat; Brasta; Emer Yoni:Dhuma Bhuta:Agni SignCapricorn vein Sign: Cancer, Leo Tihi:Owiteeya (2) Planet; Jupiter Desami (10) गया" Panchami(s) Yoni: Malanga Trayodasi (13) (Elephant ता णः Bhuta: शिशिन Sun: Pisces; 09161: Saturn, w Sign: Libra 9९01000; PlanetVenus म गिः Saptami(7) Paomminia (Ful Moan) Titni hast द) Chaturdasi (14) (न (4) Yoni: Knara (Donkey), Animal house Yoni:Vrishabha (BUI) Owadasi (2) Bra: Vays . Animal. Sarpa (Snake) Yoni Swans (Dog)

Bhuta: Jala „ AnmatOog

of the natural malefic planets are removed and the bless- ings of natural benefic planets are obtained by worship- ping the deities associated with the Tithi ruled by the plan- ets. The Sun rules Pratipada (1) and Navami (9) and Vishnu/Sri Rama respectively are worshipped on these Vedic days to get the blessings of the Sun like good health and intelligence (Pratipada) and increase in good fortune and Dharma (Navami). The Moon (Divine Mother) rules Dwiteeya (2) in the form of Bhuvaneshwari and Dasami (10) in the form of Vijaya or Chamundi. Mars rules the Truteeya (3) representing lust and Ekadasi ruling anger. Hence Ananga (alias Kaama Devata), the God of love is worshipped on Truteeya with his wife Rati to protect one- self from his arrows of passion while Hindu's keep Ekadasi fasts to destroy anger and associated evils. Ganesha is wor- shipped by studenis on Chaturthi (4) to increase their de- sire for learning (Mercury). Saraswati is worshipped on Panchami (5*Tithi also called Sri Panchami) to increase knowledge and understanding (Jupiter) as Brihaspati is --- ## Page 70 64 . Vedic Remedies in Astrology worshipped on Dhana Trayodasi (13) to augment wealth. Venus rules “Ihaloka Sukha” or all the happiness that comes from the fulfillment of desires in this birth. These desires are unlimited and being the Asura Guru, he gives knowl- ` edge of the things and acts of pleasure. To overcome this evil a person should lead a simple life and curtail desire. When this desire is denied or delayed, it gives rise to-pas- sion and envy and takes the form of a poisonous snake in the Kundalini (i.e. the Kundalini Shakti that is represented by a snake is misused for achieving mundane goals like sexual satisfaction etc.}). Thus, Shiva the overlord of all snakes is worshipped in the form of a renunciate (Sadhu/ Sanyasi) with Nagaraja (King of snakes) around His neck on Shasti (6) to overcome the evils of desire by either re- moving or fulfilling them. Worship of Shiva in this form leads to great prosperity and fulfillment of all desires. Shiva is worshipped in the form of a Linga (Golden embryo called Hiranyagarbha) on Narka Chaturdasi(14) to remove all the sins caused by desires of the past or present along with the Bull (Nandi). Saturn keeps track of all our sins and pun- ishes us during his Dasa, Sade-sati"! or Kantaka 5811112 periods. The effect of Saturn can be very disastrous and suitable remedial measures as indicated by the Kalachakra . are always advised. The two great evils that are born from the Shadripu (six weaknesses) are called ADHARMA (Anti- Dharma or anti natural principles) and ASAT (Untruth) respectively. The solution lies in increasing Dharma which causes prosperity and a good life by worshipping the SUN GOD on Rath-Saptami®® (7). To remove the evils of having told lies or behaved in an unrighteous manner in the past ` or having caused sorrow to one’s teacher (Guru), Sri Krishna is worshipped in the form of Satya-Narayana on n Sade-Sati is the seven and half transit period of Saturn as it passes through the signs in the twelfth, first and second as reckoned from the Natal Moon. Kantaka Sani means Saturn behaving like a thorn in the leg and the person has to limp in all activities of life. Profession/Career is hampered and fi- nances dwindle. The transit of Saturn in the 1%, 8५ and 10* signs from either lagna, Arudha Lagna or the Moon sign causes Kantaka Sani to operate. B Rath-Saptami is the seventh day of the hright half of the lunar month when the Sun God is worshipped sitting on His chariot (Rath means Chariot). . Vrishabha (translated as ‘Strong and righteous men’ hy Dayananda Saraswati in the Rig Veda) pull the Rath (Chariot) of Sri Jagannath (form of Sri Krishna) in a festival dedicated to protecting and increasing Dharma in Puri, Orissa. = --- ## Page 71

Poornima (Full Moon) with the mantra “OM TAT SAT” A combination of both of these remedies is to worship Krishna in the form of Sri Jagannath with the mantra “HARI OM TAT SAT” and to attend and pull His chariot during the Ratha-Yatra festival (Fig 3.2). Rahu is the cause of re-birth as it is always opposed to Ketu the cause of Moksha or emancipation, Rahu represents all kinds of curses and bond- ages including re-birth. Thus, to overcome the evils of ones Karma that cause rebirth, Krishna is worshipped in the form of Bal-Gopal (Baby Krishna} on Janmastami (8* Tithi) and the Divine Mother is worshipped in the form of Kali (Satwik worship is advised) on Amavasya (Dark fortnight- New Moon). Please note the specific association of the plan- ets and the Tithi (Vedic days) in the Kalachakra.

Having determined the Ista and other Devata, the next step is to determine the Kastha Phala (Problem causing pain/ sorrow). For those adept at using the Prasna Chart and the Hora, this is relatively simple. Draw the Prasna Chart for the moment and determine the Lord of the Hora of the time of query. The placement of the Lord of the Hora will indicate the aspect of life troubling the mind. The Arudha Lagna will be the Area of life the problem relates to. If a malefic is in Arudha Lagna (Maya Peetha) and a Benefic in Lagna (Satya Peetha), then be assured that the problems going to be solved quickly. Instead if a malefic is in Lagna and benefic in Arudha Lagna, know that the prob- lemis very deep-rooted and perhaps quite difficult to solve. The Lord of the Hora shows the immediate cause of mani- festation of the problem. The other rules can be learnt from Prasna Marga or any other standard text. ¥ This particular form of Sri Krishna as the Teacher of this entire Universe is known as Sri Jagannath. Since in this form, He is giving enlightenment, the planets Sun & Jupiter combine to represent Him, We see the mention of this Vishwaroopa form (fJagal-Natha or Lord of Universe) in the Bhagavat Gita and it si for this reason that Maharishi Jaimini gives the Dictum that the Sun in trines to Karakamsa/Swamsa gives the knowledge of the Gita, which is the Vedanta (leads to emancipation). The Rig Veda (I[1.62.7) states “VRISHABHAM CHARSHANINAAM VISHWAROOPAM- ADARIIYAM BRIHASPATIM VARENYAM". --- ## Page 72 66 Vedic Remedies in Astrology

Chart 3.2 Prasna by a Lady on 28 July 1999 7.35 AM New Delhi CHART 3-2 PRASNA Rasi D-1 CHART 3-2 NAVAMSA Chart 3-2 is the Prasna (Query) of a Lady. The time is ` the second Hora of Wednesday. This is ruled by the Moon. The Moon in the sixth house indicates that the Prasna re- lates to a forthcoming fight/ duel etc. and this would be the second (Moon) attempt. The Lady was surprised that] could say all this and stated that she wanted to know whether her husband would get a ticket to fight the forthcoming election in Andhra Pradesh, and the outcome, The Lagna with the tenth Lord shows the objective of Power and position. The Lagna Lord Sun in a house of the Moon shows that this is the second attempt and that there are too many secret enemies (Rahu) who threaten to eclipse --- ## Page 73 “Astrological Principles 67 ‘the beginning (Sun). The Sun indicates the beginning i.e. the question of getting the ticket ant its dispositor Moon going to the sixth is not desirable. Further, the 11% Lord Mercury (gain of final objective) is retrograde and also placed in Cancer in the 12* house. While this combination denies success, its conjunction with the Sun can show gain ` of objective. Propitiation of the Shiva (Sun) was advised by offering 108 Bel Leaves (Mercury) in the morning,

The deep-rooted problems have been explained in the Brihat Parasara Hora Shastra where the curses that cause delay or denial in childbirth are indicated. These can also be suitably extended to other houses. The principle is that the house, its Lord as well as its natural significator should all be afflicted either together or separately by malefics. These are as follows:

Jupiter indicates Brahmins & priests. Affliction of Ju- piter by Saturn and Mars or by Rahu indicates the curse of a Brahmin (Priest or spiritual person) in the last birth. The houses owned by Saturn shows the area of trouble. A Brah- min will also fulfill the curse of a Brahmin, although he would be of very bad temperament and nature. Remedy lies in Chandrayana'™ Vrata (fasting) and donation of cows, five gems and some gold. : CHART 3-3 - SRI RAM RASI (0-1 Chart) _—— — -------- ¥ Instead of Chandrayana Fast, worshipping Lord Shiva on Mondays is a definite method of getline relief from the curse of a Brahmin, --- ## Page 74 68 Vedic Remedies in Astrology Chart 3.3 is the horoscope of Bhagawan Sri Ram- chandra. Jupiter is the ninth Lord (Guru) in Lagna with the Moon showing a powerful Gajakesari Yoga as well as Hamsa Mahapurusha Yoga. The presence of other exalted planets in quadrants also constitutes powerful Mahapurush Yoga like Ruchak (Mars) and Sasa (Saturn), besides Dharma Karmadhipati yoga etc. Yet anyone who has read the Ramayana will see how much suffering Bhagawan had to undergo in this incarnation. Thus, the presence of acurse can mar the fructification of a Rajyoga. Jupiter is aspected by Saturn and Mars showing the curse of a Brahmin'** Since Jupiter is in Lagna, Sri Ram had to undergo this suffering. The houses owned by Saturn indicate the aspect of life where the suffering will occur. Here, Saturn is the Lord of the 7५ and 8" houses and the seventh house is stronger to indicate the problem area as marriage / married life. Ravana ` the Lanka King abducted his wife Sri Sita and they had to undergo untold suffering leading to the death and destruc- tion of the Demon King. Ravana was a Brahmin by birth (but not by Karma). Bhagawan Sri Ram worshipped Lord Shiva at Rameshwar (just before the battle with Ravana) and was redeemed from the curse. 3.3.1.2, CursEt oF SERPENTS (RaHU): Rahu indicates the serpents. Its affliction of a house, its lord or its significator (either together or separately) with either Saturn or Mars shows the curse of serpents. The curse of serpents is very destructive in nature and results in the gradual destruction of a house due to the spread of poison in that house. The curse of serpents is also seen in such adverse yoga like Sarpa Yoga (presence of three or more malefics in quadrants) or Kalasarpa Yoga (all planets hemmed between the nodes). Remedy lies in making an ¥ As per tradition, Devarshi Narada was struck by the arrow of his younger brother Kama Devata (God of Love) and wanted to marry which amounted to breaking his solemn promise of celibacy. Sri Narayana (Vishnu) turned his face into that of a monkey and the bride rejected him. Learning about this, Narada flew into a rage and cursed Narayana that He too would have 10 suffer the loss of His beloved 5ri Lakshmi. In order to fulfill the words of His ardent Devotee as well as to establish Dharma the Lord incarnated as Sri Ram. --- ## Page 75 ५ ‘Astrological Principles 69 idol of Nagaraja" (Lord of Serpents) in Gold and worship- ping it. Donate a cow, some land, sesamum seeds and a little gold. In the case of Sarpa Yoga, the presence of ben-- efic planets in quadrants destroys the Sarpa Yoga while for Kalasarpa Yoga, the presence of benefic planets in either the Lagna or 7* house or conjoining either of the nodes destroys the Kalasarpa yoga. In such cases, the Moon break- ing the Yoga results in Mahasankha Yoga whereby fast- ing on Mondays and worshipping Lord Shiva and Naga- . raja’ is advised. If Jupiter is the planet, then the resultant Yoga is called Mahapadma Yoga and fasting on Thurs- days and worshipping Lord Vishnu and Sri Balaram® is advised. In this manner the remedial measures can be pre- scribed. 3.3.1.3. Curse oF FATHER (Sun): Although the ninth house rules the Father, the rela- tionship of Father & son is focused on the artha-trikona® of both especially the tenth house through which the Karma is transferred. Thus, affliction of a house, its Lord and significator by the Sun and other malefic planets (either jointly or separately) results in Pitrishapa®. Alternately, ‘the placement of the tenth lord and its affliction by malefics in its trines as well as in the ascendant shows the Pitri-Rina (see footnote under artha-trikona). Remedial measure lies in performing Shraddha (Last rites), feeding Brahmins, * ए See table 2.5 for determining the serpant (Sarpa) accompanying the Sun van Hn (Soul). Nagaraj is the King of serpants who forms a protective garland for Lord Shiva. This is symbolized by the rosary of 108 Rudraksh beads. Sri Balaram is the incarnation of Seshanag, the thousand-headed serpant who coils into a bed for Lord Vishnu (Ananta sayana) and works as His guardian. Artha-Wealth; Trikona-trines. Thus artha-trikona from the ascendant and the ninth house are the 2", 6™ and 109 houses. This formed the basis of the casle system whereby the son followed the same profession as his father. “Thus the 2" house gives the Jati or family/lineage. Tf चाकाशं च मानं चैव पितुस्तथा ! प्रवासस्य ऋणस्यापि व्योमस्थानानिरीक्षणम्‌ | । (BPHS 11.11) The place of power, authority & profession is seen in the tenth house, The tenth house is the focus for determining Iitri-Rina or the debts of Father and ancestors in the Patriarchal lineage (The entire theory of Karma and Samsara Is based on this foundation). Besides, it being the opposite to the 4% house, it rules “leaving home”.

--- ## Page 76

performing (funding & arranging) a marriage, giving acow (or Bhagavat Gita) in charity etc 3.3.1.4. Curse oF MoTtHER (Moon) The 4* house, its lord and the Moon signify Mother The Moon should be ina house under severe affliction from malefics, especially Saturn and/or the 4* and ascendant Lerd should be ill placed or afflicted. Simultaneously, the lord of the house where the curse falls should also be af- flicted. Remedy lies in taking a dip in the holy waters of ` Rameswaram (South India) and reciting the Gayatri Man- प्व 1 Lakh times and finally doing 1008 Parikrama (going around in the clockwise direction) of a Pipal tree or a Vishnu temple while reciting the Mahamantra or the Janaka Shadakshara mantra. 3.3.1.5. Curse oF BROTHER (MARS): Mars, the third house and lord signify brother. Mars afflicting a house as the lord and significator of that house are afflicted elsewhere and related to trines shows the curse of a brother. Alternatively, the third lord replacing Mars also shows the curse of brother. Remedy lies in performing Chandrayana Vrata (or Ekadasi Vrata?) and reading the ` Harivamsa Purana; planting holy trees and plants like the ` Pipal, Tulsi etc; performing penance/ holy dip near the three rivers Ganga (which marks the beginning of the Harakshetra or Himalayas), Mahanadi (which marks the beginning of the Srikshetra or Jagannath) and Kaveri {which marks the beginning of Arkakshetra or Rames- waram); donating cows through one’s spouse and donat- ing land having mango trees. 3.3.1.6. Curse oF MATERNAL UNCLE (MERCURY): Mercury, the sixth house and Lord signify maternal uncle. These under affliction related to any house show the curse of a Maternal uncle in the last birth. Remedy lies in the installation and worship of an idol of Sri Vishnu or the construction of a well, dam or reservoir for public welfare. य Ekadasi is the 11५ and 26५ day of the Lunar Month --- ## Page 77

3.3.1.7. Curse oF Wire (VENUS) Venus, the seventh house and Lord indicate wife. These under affliction related to any house show the curse of wife in the last birth. Remedy lies in the donation of an idol of Lakshmi-Narayana, fertile cow or abed/ ornaments/ gar- ments for a newly married couple. Alternatively, by help- ing other people to marry and settle down, one is relieved of the curse.

Saturn & Sun or Saturn & Moon combination / aspect in any house shows the curse of departed soul of a pater- nal or maternal elder respectively. Similarly, Saturn with other malefics afflicting a house as its lord is related to the 8" house also shows this. The combination of Saturn and a node in the visible signs shows that the last rites of father will not/have not been performed while in the invisible signs, it indicates the same for mother. The lord and significator of a house in their signs of debility also indicate the curse of departed souls. Remedy lies in Shraddha (Pinda dana), Rudrabhishek, or donating a gold idol of Brahma, a cow, vessel of silver and Neelam (Blue sapphire). 3.3.2. FLaws IN THE QUALITY oF TIME * Maharishi Parasara has described the following birth time to be inauspicious as it indicates considerable turmoil for both the native and family. Irrespective of the fine yoga's obtaining in the chart, these moments are inauspicious for births as well as starting any activity. These are broadly called Dosha (Flaw or fault in the quality of time) and in- clude Tithi Dosha, Karanadi Dosha, Nakshatra Dosha Surya Dosha, Upagraha Dosha, Gandanta Dosha and Trideva Dosha 3.3.2.1. Titi DosHa; Tithi is the Vedic Lunar day reckoned from the Full Moon or New Moon wherein each day is equal to a lunar transit of 12° from the Sun. The birth in Amavasya?®, ॐ Amavasya: 15* day of the waning phase when the Moon is between 348° to 360° from the Sun. ॥ . --- ## Page 78 72 ` Vedic Remedies in Astrology Krishna Chaturdasi*, Soonya Tithi (Zero effect पापा) and Dagdha Tithi (Combust Tithi) are considered inauspicious. 3.3.2.1.1. Amavasya This Tithi is ruled by Rahu and is considered very in- auspicious as it brings poverty on the person born as well as the family. It rules hell and brings untold misfortunes. A lady born in this Tithi is said to become a widow early. However, if suitable remedial measures are performed, then great wealth is obtained through foreign connections & trade, or from mines etc. from below the ground. A female bornin such a combination also begets three sons after the remedial measures. Since Rahu afflicts the Sun and Moon, the remedy lies in worshipping them in the direction of Rahu (South-West). Thus, choose a suitable place in the Southwest direc- tion. Install a water vessel (kalash) containing Ganga water (preferably water from a holy place} and the Pancha- pallava®. Install the idols of the Sun & Moon near it. Wor- ship the idols with the Mantra “ 04. ayasva” (अप्यायस्व) for the Moon and the Mantra “Savita” (सविता) for the Sun. There- after performing a Yagna®, the water from the vessel should be poured on the child and the parents. Donate some gold, silver and a black cow. Be of service to the priests or make some donations for their welfare. For those who cannot perform the elaborate ritual, it is advisable to install a simple water pot and worship the Sun & Moon near it with the mantra’s. They can also worship Goddess Kali the deity of Amavasya Tithi. However, the Astami Tithi is also ruled by Rahu and persons born in it should worship Sri Krishna for protection. In Chart 3-4 the Sun 15 at 11°as the Moon is at 10°in Libra. Thus, the birth is in Amavasya Tithi and the Lady although born in an affluent family had to undergo untold financial hardships. The family undertook some remedial measure in the form of regular worship of Goddess Kali. 4 Krishna-Chaturdasi: 14" day of the waning phase when the Moon is between 336° to 348° from the Sun. = Leaves of the five plants Goolar (wild fig), Vata (Banyan), Pipal, Mango & Neem. ४ Fire sacrifice where prescribed fuels are thrown into a small copper vessel containing the holy fire. --- ## Page 79 _ Astrological Principles . 73: Chart 3.4 Female Born on 28" October 1943, 5:45 1 IST; 20N51, 86E20 Birth on Amavasya Tithi.

containing the holy fire. --- ## Page 79 _ Astrological Principles . 73: Chart 3.4 Female Born on 28" October 1943, 5:45 1 IST; 20N51, 86E20 Birth on Amavasya Tithi.

RASH (0-1 Chart) Hence, she married early and had three sons. However, disaster struck with the advent of the dasa of Saturn and ` the financial hardships started to increase. Her husband had a terrible accident and was bedridden for a month or _ 50, but survived miraculously. Saturn is the lord of the sec- ond from the Upapada (UL) indicating spouse and is placed in the 7% house from UL. Thus the remedial measure did work to a large extent. 3.3.2.1.2. Krishna-Chaturdasi The Krishna Paksha Chaturdasi Tithi occurs when the Moon 15 at a distance of 336° to 348° from the Sun. it is also called Narka (Hell) Chaturdasi. This span of 12°is divided ` {110 six parts of 2° each with the results as follows: Table 3-1 Krishna Chaturdasi Effects Part | Extent (Moon Sun) 1 | The effect is of the Rudra in the first house 338-340 Destruction or death of Father | The effect is of the Rudra in the third house, - causes death of father. © | Death of Mother The effect is of the Rudra in the fifth house, being Lhe second from the fourth causes the ’ death of mother. 342-344 Death of maternal uncle The effect is of the Rudra in the seventh | | house. Being the second from the sixth ह causes the death of maternal uncle. © | Destruction of the lineage The effect is of the Rudra in the 11% house, Being the seventh from the 5%, jt destroys (च the lineage or progeny and next generation. The effect is of Rudra in the ninth house. ` Death or destruction of the native --- ## Page 80 74 - Vedic Remedies in Astrology Remedy lies in worshipping a gold idol of Lord Shiva” | having a crescent moon on the forehead, a white garland around the neck, with three eyes (One in the middle of the forehead), dressed in white robes, seated on a bull and with two arms having the ‘Varada'(m®) & ‘Abhaya’ (अभय) Mudra. The worship begins with theinvocation of Varuna in a water pot placed in the North Eastern direction followed by the. worship of Tryambakkam, Agni etc. Rudrabhishek® of the idol is performed and the navagraha” worship is done. The ceremony ends with the Yagna. This should be per- formed only by competent priests. Alternatively, daily worship of Lord Shiva in the form of Somanath (Lord of the Moon) preceded by the worship of Varuna (Lord of the waters) saves a person from Narka (Hell) and Yama (God of death). 3.3.2.1.3. Soonya & Dagdha Tithi |. . The Tithi are classified on the basis of the थद्वप as Nanda (1, 6 & 11), Bhadra (2, 7 & 12), Jaya (3, 8 & 13), Rikta (4, 9 & 14) and Poorna (5, 10 & 15). If the Tithi is Ghatak’ (afflicts) to the Moon sign then it is Soonya (Zero effect) Tithi, whereas if it is Ghatak to the Sun sign, then it is Dagdha (Combust) Tithi. : , Table 3-2 Ghatak Chakra Moon sign at Birth | Ghatak/ Affliclin Tithi [Day | Nakshatra | Lagna Nanda | Sunday Makha Taurus Virgo Poorna | Saturday Hasta Gemini Aquarius | Bhadra | Monday Swati Cancer Leo Bhadra | Wednesday | Anuradha

Vir, Gemini Poorna | Saturday Sravana “लिया _ । Satabhisaj | Virgo a; i Revati Scorpio | Pi ya | Friday | Dweja

i Leo

४ This particular form of Lord Shiva is most adored by the Brahmins and is popularly known as the Jyotirlinga SOMANATH. 28 Holy bathing with the recitation of Mantra 2 Nine Plancts # Five elements or states of matter/energy. 3 Ghatak refers to days and limes when bodily affliction can occur. Hence, this is studied from the Chandra (Moon) Lagna Chart ie. treating the Moon sign as ascendant. --- ## Page 81

Remedy for Soonya Tithi lies in the worship of the Moon whereas for birth in Dagdha Tithi the worship of the Sun/Shiva is advised. Alternatively, the worship of the deities of the Sun (Rama) and Moon (Krishna) with the Janaka Shadakshara Mantra (Hare Rama Krishna) removes the blemish. Soonya Tithi indicates some deep sorrow to mother at the time of birth whereas the Dagdha Tithi indi- cates sorrow of father at the time of birth. In these cases, the Moon/ Sun respectively become very weak and need to be strengthened by using gems, Mantra etc. For example in Chart 2, the Moon sign is Aquarius and the Janma Tithi is Krusna-Truteeya (K-3). This is a Jaya Tithi and is Ghatak for Kumbha Rasi (Aquarius Moon sign) as per the table 3.2. This is Soonya Tithi indicating a very weak Moon. At the time of birth of the native the mother was very sad and weeping due to the demise of her grand- mother a few weeks back. 3.3.2.2. KaraNADI DosHaA Birth in Bhadra Karana, Tithi Kshyaya etc. is not con- sidered auspicious and remedial measures are advised. Remedy for birth in Bhadra Karana lies in the worship of Lord Vishnu and other accompanying deities on an auspi- cious date (Preferably when Mercury is strong) or on a Thursday, whereas the blemish of birth in Tithi Kshyaya is removed by showing a Ghee Lamp to Lord Shiva in the evening, 3.3.2.3. UraGRaHA DosHa Birth at the time of Vyatipata, Paridhi, Vajra etc. orin Yamaghantaka is inauspicious. Remedy lies in the Parikrama (going around in the clockwise manner while reciting the Mantra) of the Pipal tree 108 times for improv- ing the Longevity, Yagya for Lord Vishnu or Rudrabhishek for Lord Shiva. 3.3.2.4. Surya DosHA Errors associated with the Sun are called Surya dosha. --- ## Page 82 76 Vedic Remedies in Astrology This could be either due to birth at the time of sankranti ` (6019) ingress into a sign) or due to birth during an eclipse. 3.3.2.4.1. Sankranti (Solar ingress) Birth in Sankranti® causes Surya dosha. Depending on the day of birth, the names of the seven Sankranti are Ghora, Dhwanshi, Mahodari, Manda, Mandakini, Mishra and Rakshashi. Surya dosha causes poverty, loss of health ` and many troubles related to the profession. The remedial measure in the form of a religious ritual is very elaborate and should be performed be a competent - priest only. It includes installation of the water pot in the eastern direction followed by the worship of the Navagraha. The water pot (Kalasha) should contain holy water, ` Saptamrittika®, Shastaushaddhi*, Panchapallava, and Panchagavya. The idol of the Sankranti (as per weekday) is installed along with the Adhidevata (Sun) and ` Pratiadhidevata (Moon) and worshipped. The idol of Sankranti is worshipped with the “Tryambakkam” or Mritunjaya Mantra while that of the Sun with the “Utsurya” Mantra and the Moon with the“ Apyayaswa” Mantra. This is followed by a Yagna and the sprinkling of the water from the Kalash on the head of the parents and child. Alterna- tively, those who cannot have this elaborate ritual per- formed should recite the Navagraha stotra of Vyasadeva followed by the Mritunjaya Mantra (108x2 times daily for 40 Days). ` 33.242. Eclipse ` Birth in a solar eclipse causes poverty and many hard- ` ships while that in a lupar eclipse causes physical ailments and all kinds of health problems. Determine the lord of the constellation in which the eclipse occurs at birth and pre- scribe remedial measures. Day of ingress of the Sun into a sign. ® Saptamrittika is the seven Rasa as given under Saptamsa in the previous . chapter. _M Six fundamental medicinal herbs --- ## Page 83

Astrological Principles = 77

[No] Constellation (1 [Asw 2 Bharim

Aswini Kumar | 15 | Swati ` Indra Yama 16 | Visakha Mitra श्च Ardra 7 Punarvasu Adit 21 | Uttarasadha Brahma | है. | Pusva 0111185 239६ 22 | Sravana Vishm नल Aslesha _ 5911937 Dhanista ` Vasudeva 10 | Makha 21 [दन्य | Varuna 11 | Poorva Phalguni | Aryama | 25 _ | Poorvabhadrapad | Ajapada Ea मील किगासद 13 | Hasta Vishwa Karma | 27 | Revati Pooshan द्र - 14 ; Chitra _ | Vayu एक | Abhijit | Hari oie 8 [4 Prepare an idol* of the deity of the constellation and in addition an idol of the Sun if birth is in solar eclipse or of the Moon in silver if the birth is in lunar eclipse. Another idol of Rahu should be made of Lead. People who cannot afford the idols can use gold/ silver/lead-plated coins with the drawings or markings of the Sun/Moon/Rahu respec- tively. After worshipping the Lord of constellation with the mantra for the constellation (see next chapter), the Sun with the “ Aakrishnena” Mantra*! or the Moon with “Imam Deva” Mantra®?, Rahu is worshipped with the “Kayanaschitra” Mantra®® The offerings to the Sun are red sandal paste, red colored rice, garland of red flowers, red clothes etc. while that to the Moon are white sandal paste, white flow- ers & garland, white clothes etc. Rahu is offered black Moon Jupiter

Snakes ruled by Rahu

Surya or Sun

The idol of the deity of the birth constellation can also be made of the wood of Pipal tree. Alternatively, the idol of Sri Jagannath (Sri Krishna as Lord and teacher of the Universe) can be used for all constellations for removing any form of blemish on the Moon, its sign or constellation. These idols are always + made of wood and nails are not used. The arms are made with dovetail foints and the wood is of the Neem tree. The carpenter is required 10 recite the Bhapavat Gila at the time of preparation of the idol. ५ This is the Vedic Mantra of the Sun and has been provided in Chapter ४. * This is the Vedic Mantra of the Moon and has been provided in Chapter V. « Ths is the Vedic Mantra of the Rahu and has been provided in Chapter ४, | छ # श ह त --- ## Page 84 78 ` Vedic Remedies in Astrology clothes, Kagjal (black sooth), black flowers etc. Finally, the Yagya is performed. Samidha refers to the small pieces of ` wood offered to the holy fire. Samidha for the Sun 15 from the 4 tree, for the Moon from the Palasa tree, for Rahu Doorva grass is used while for the deity of the constellation Samidha from the Pipal tree is used. The ritual ends by of- , fering the Dakshina* to the priest and breaking the fast. 3.3.2.5. GanDaNTa DosHa Gandanta Dosha is of three kinds. These are Lagna Gandanta, Rasi Gandanta and Tithi Gandanta. 3.3.2.5.1. Rasi Gandanta ‘Gandanta refers to the junction signifying end or a new beginning and in the Bha-Chakra (Zodiac) the three ` points of Zero degree Aries, Leo and Sagittarius in the junction of the Fire and Water signs shows the Gandanta. These are called Nabhi (Navel of Brahma the Creator). The Gandanta stretches for 3° 20" on either side of these points. Thus, the last quarter of Jyestha Nakshatra and the first quarter of Moola Nakshatra are called Jyestha Gandanta ‘and Moola Gandanta or Abhukta Moola. The deities of these two constellations are Indra and Rakshas respectively and are highly inimical to each other. Similarly the junction between Aslesha and Makha constellations (last quarter of Aslesha in Cancer and first quarter of Makha in Leo) is very inauspicious. These four quarters have been given the * highest negative value requiring the donation of three cows (or alms). The other junction between the last quarter of Revati in Pisces and the first quarter of Aswini in Aries is also baneful, but has a lesser inauspiciousness value of two Cows. More precisely, the three Ghatika (1 hour 12 minutes) after the start of the first constellation of fiery signs and five Ghatika (2 Hours) before the end of the last constellation of watery signs is called Gandanta. [f birth is in the daytime, ` ‡ 15 called Pitri* Gandanta while a night birth during “Gandanta is called Matri* Gandanta. Another classification #A token of gratitude in the form of alms, clothes, rice etc. Some people offer cows. # Pitri- Father or father related + Matri- Mother or mother related --- ## Page 85 ‘Astrological Principles 79 15 that the birth in Revati (Pisces) ~Aswini (Aries) junction ` 15 called Swa* -Gandanta, birth in Aslesha (Cancer) - 'Magha (Leo) junction is called Matri Gandanta while that in the Jyestha (Scorpio) = Moola (Sagittarius) junction is called Pitri Gandanta -Abhukta Gandanta Narada Muni has stated that of these six constellations, ‘the “Abhukta Moola Gandanta” comprises the last two Ghatika (48 minutes) of Jyestha and first two Ghatika (48 minutes) of Moola constellation. [The times given here are for the lunar transit and not degrees of the zodiac]. He adds that such a child should be abandoned (or given away) or any form of hope from him should not be made. If the child survives, father should not see his face for 8 years after birth. Other authorities indicate 27 days for this abstainance of father from seeing the face of the child, which seems more practical in today’s context. Thereafter suitable remedial measures should be performed. - Moola-Nivasa (Residence of Moola) In the Vedic months of Margasira phalgun, Vaisakha and Jyestha the residence of Moola isin “Patala Loka” (the ` hell). In Sravana, Kartika, Chaitra and Pausa the residence of Moola is in Martya Loka (the realm of Dead). In the four -Vedic months of Ashada, Aswina, Bhadraand Magha, the residence of Moola is in Swarga Loka (the Heavens)* In birth is in Gandanta and the residence of Moola is . in the realm of the dead (Martya Loka) then great evil is ‘indicated. The evil is lesser for the other Loka. Movable fixed and dual signs in the ascendant (Lagna) are said to give “Moola residence of Swarga (Heaven), Patala (Hell) and Martya loka (Death realm), respectively. 3.3.2,5.2. Lagna Gandanta In the junction of water & fire signs Lagna Gandanta ¥7 Swa- Self or self afflicting ५ Maharshi Gargi has a divergent view on the allocation of months for the loka He gives Vaisakh, Sravana, Kartika & Magha for Swarga Loka; Ashada Pausa, Margasira, Jyestha for Martya loka and Aswina, Chaitra, Phalguna and Bhadra for Patala loka residence of Moola. --- ## Page 86 80 "Vedic Remedies in Astrology exists for duration of 1 Ghatika 15 Vighatika each in the ` end/beginning respectively. [Note: 1 Ghatika 15 Vighatika is a duration of 1 hour. The second half of water sign and first half of fire signs have this Gandanta (However, most authorities agree that the Gandanta is in the related constellation). The Lagna falling in any of these points causes Lagna Gandanta while the Moon in these quarters causes Rasi Gandanta. : 3.3.2.5.3. Ganda Phala: (Results of birth in Gandanta). Lagna Gandanta results in the loss of intelligence while Rasi Gandanta results in premature death or loss of longevity. The remedy lies in.worshipping the Lord of the Lagna/Moon constellation depending on the type of Gandanta. This deity becomes the Devata (Deity-in-Chief). Since the affliction comes from an adjoining sign, the lord of the nature of the sign becomes the Adhi-Devata and the lord of the afflicting constellation becomes the Pratyadhi- Devata. For example, let us determine the deities for Jyestha Gandanta. The Lord of the Jyestha constellation (as per table 3.2) is Indra. So, Indra is the Devata or Chief deity. Jyestha is in Scorpio and the junction affliction comes from the sign Sagittarius having the Moola constellation. Sagittarius is a fiery sign and the God of fire Agni is the Adhi-Devata. Moola is the afflicting constellation and the Lord of this constellation (as per table 3.2) is Rakshas who is the Pratyadhi-Devata. The ritual is normally performed in the Eastern or Northern part of the house depending on whether the Gandanta is in a fiery sign (East) or watery sign (North). The Kalasha (water pot) containing Panchagavya, Shastaushadhi and Ganga water is installed. The idol of the Devata is installed on another earthen pot adjoining the Kalasha or a gold coin can be used to represent the deity. Similarly, the Adhi-devata and Pratyadhidevata are also installed and worshipped (For more details refer to BPHS). This is followed by a Yagya (Fire sacrifice) & Abhishek (Ritual bathing with Mritunjaya Mantra). The water from the two Kalash whould be poured on the head of the parents and the child. Donations, (Dakshina) and breaking of fast ends the ritual. Rudrabhishek as well as ceremonial bathing of the afflicted persons is necessary. For --- ## Page 87

* This is the Vedic Mantra of the Moon and has been provided in Chapter V. « Ths is the Vedic Mantra of the Rahu and has been provided in Chapter ४, | छ # श ह त --- ## Page 84 78 ` Vedic Remedies in Astrology clothes, Kagjal (black sooth), black flowers etc. Finally, the Yagya is performed. Samidha refers to the small pieces of ` wood offered to the holy fire. Samidha for the Sun 15 from the 4 tree, for the Moon from the Palasa tree, for Rahu Doorva grass is used while for the deity of the constellation Samidha from the Pipal tree is used. The ritual ends by of- , fering the Dakshina* to the priest and breaking the fast. 3.3.2.5. GanDaNTa DosHa Gandanta Dosha is of three kinds. These are Lagna Gandanta, Rasi Gandanta and Tithi Gandanta. 3.3.2.5.1. Rasi Gandanta ‘Gandanta refers to the junction signifying end or a new beginning and in the Bha-Chakra (Zodiac) the three ` points of Zero degree Aries, Leo and Sagittarius in the junction of the Fire and Water signs shows the Gandanta. These are called Nabhi (Navel of Brahma the Creator). The Gandanta stretches for 3° 20" on either side of these points. Thus, the last quarter of Jyestha Nakshatra and the first quarter of Moola Nakshatra are called Jyestha Gandanta ‘and Moola Gandanta or Abhukta Moola. The deities of these two constellations are Indra and Rakshas respectively and are highly inimical to each other. Similarly the junction between Aslesha and Makha constellations (last quarter of Aslesha in Cancer and first quarter of Makha in Leo) is very inauspicious. These four quarters have been given the * highest negative value requiring the donation of three cows (or alms). The other junction between the last quarter of Revati in Pisces and the first quarter of Aswini in Aries is also baneful, but has a lesser inauspiciousness value of two Cows. More precisely, the three Ghatika (1 hour 12 minutes) after the start of the first constellation of fiery signs and five Ghatika (2 Hours) before the end of the last constellation of watery signs is called Gandanta. [f birth is in the daytime, ` ‡ 15 called Pitri* Gandanta while a night birth during “Gandanta is called Matri* Gandanta. Another classification #A token of gratitude in the form of alms, clothes, rice etc. Some people offer cows. # Pitri- Father or father related + Matri- Mother or mother related --- ## Page 85 ‘Astrological Principles 79 15 that the birth in Revati (Pisces) ~Aswini (Aries) junction ` 15 called Swa* -Gandanta, birth in Aslesha (Cancer) - 'Magha (Leo) junction is called Matri Gandanta while that in the Jyestha (Scorpio) = Moola (Sagittarius) junction is called Pitri Gandanta -Abhukta Gandanta Narada Muni has stated that of these six constellations, ‘the “Abhukta Moola Gandanta” comprises the last two Ghatika (48 minutes) of Jyestha and first two Ghatika (48 minutes) of Moola constellation. [The times given here are for the lunar transit and not degrees of the zodiac]. He adds that such a child should be abandoned (or given away) or any form of hope from him should not be made. If the child survives, father should not see his face for 8 years after birth. Other authorities indicate 27 days for this abstainance of father from seeing the face of the child, which seems more practical in today’s context. Thereafter suitable remedial measures should be performed. - Moola-Nivasa (Residence of Moola) In the Vedic months of Margasira phalgun, Vaisakha and Jyestha the residence of Moola isin “Patala Loka” (the ` hell). In Sravana, Kartika, Chaitra and Pausa the residence of Moola is in Martya Loka (the realm of Dead). In the four -Vedic months of Ashada, Aswina, Bhadraand Magha, the residence of Moola is in Swarga Loka (the Heavens)* In birth is in Gandanta and the residence of Moola is . in the realm of the dead (Martya Loka) then great evil is ‘indicated. The evil is lesser for the other Loka. Movable fixed and dual signs in the ascendant (Lagna) are said to give “Moola residence of Swarga (Heaven), Patala (Hell) and Martya loka (Death realm), respectively. 3.3.2,5.2. Lagna Gandanta In the junction of water & fire signs Lagna Gandanta ¥7 Swa- Self or self afflicting

He gives Vaisakh, Sravana, Kartika & Magha for Swarga Loka; Ashada Pausa, Margasira, Jyestha for Martya loka and Aswina, Chaitra, Phalguna and Bhadra for Patala loka residence of Moola. --- ## Page 86 80 "Vedic Remedies in Astrology exists for duration of 1 Ghatika 15 Vighatika each in the ` end/beginning respectively. [Note: 1 Ghatika 15 Vighatika is a duration of 1 hour. The second half of water sign and first half of fire signs have this Gandanta (However, most authorities agree that the Gandanta is in the related constellation). The Lagna falling in any of these points causes Lagna Gandanta while the Moon in these quarters causes Rasi Gandanta. : 3.3.2.5.3. Ganda Phala: (Results of birth in Gandanta). Lagna Gandanta results in the loss of intelligence while Rasi Gandanta results in premature death or loss of longevity. The remedy lies in.worshipping the Lord of the Lagna/Moon constellation depending on the type of Gandanta. This deity becomes the Devata (Deity-in-Chief). Since the affliction comes from an adjoining sign, the lord of the nature of the sign becomes the Adhi-Devata and the lord of the afflicting constellation becomes the Pratyadhi- Devata. For example, let us determine the deities for Jyestha Gandanta. The Lord of the Jyestha constellation (as per table 3.2) is Indra. So, Indra is the Devata or Chief deity. Jyestha is in Scorpio and the junction affliction comes from the sign Sagittarius having the Moola constellation. Sagittarius is a fiery sign and the God of fire Agni is the Adhi-Devata. Moola is the afflicting constellation and the Lord of this constellation (as per table 3.2) is Rakshas who is the Pratyadhi-Devata. The ritual is normally performed in the Eastern or Northern part of the house depending on whether the Gandanta is in a fiery sign (East) or watery sign (North). The Kalasha (water pot) containing Panchagavya, Shastaushadhi and Ganga water is installed. The idol of the Devata is installed on another earthen pot adjoining the Kalasha or a gold coin can be used to represent the deity. Similarly, the Adhi-devata and Pratyadhidevata are also installed and worshipped (For more details refer to BPHS). This is followed by a Yagya (Fire sacrifice) & Abhishek (Ritual bathing with Mritunjaya Mantra). The water from the two Kalash whould be poured on the head of the parents and the child. Donations, (Dakshina) and breaking of fast ends the ritual. Rudrabhishek as well as ceremonial bathing of the afflicted persons is necessary. For --- ## Page 87

(1) day Ganda dosha father and child (2) Night birth Ganda dosha Mother & child and (3) Sandhya (Sunrise/ sunset) born Ganda dosha both father & mother and child are protected with Abhishek using four vessels of water etc and Sahasraksha Mantra. People who cannot afford these elaborate rituals should recite the Mahamritunjaya Mantra eight thousand times within 40 days starting from the 12% day from the birth of the child. [t maybe noted that remedial measures cannot be performed for 11 days following birth. ‘Besides what has already been stated, there are other methods of determining the results of gandanta. The num- ber of the birth asterism (Janma Nakshtra) is multiplied by three (3). The numbers of birth tithi (as recknoed from Sukla Paksha prati pada) and the day of birth (as reckoned from Sunday) are added and the sum is divided by eight (8). The remainder indicates the Ganda Dosh (Error/ Evil) as given in table3-4. Table 3-4:Ganda Dosha Remainder| Ganda Type Results 1 Moola Ganda (F7mws) Mula Vinasha मल विनाश) : Complete destruction of ideals and perso- nality/ identity of the self or death. 2 Stanwa Ganda Dhana Nasha (धन नाधो: Destruction of (=a गण्ड) wealth. 3 Twaccha Ganda Matri Vinasha (wig विनाश): Destruction (तच्छ गण्ड) of mother (and maternal relation). ५ 4 Sakha Ganda {rar mus} Atma Shakti Vinash (जला शक्ति Ren): Destruction of physical power and mantel strength. Patra Ganda {पत्र ms) Matula Nasha (mgm नाश); Destruction of maternal grand father (also maternal relations). w 6 Pushpa Ganda (पुष्प षण्ड) Bhratri Vinasha (मातू विनाश): Destruction of Co-borm. 7 Phala Ganda (फल गाड) Pitri Vinasha (fg विनाश): Destruction of Father. 8 Sheeshna Ganda Sarva Vinasha (vd विनाश): Complete शिषन गण्ड destruction. Example: Male born on 28 March 1962. Tithi: Saptami (7) Krisna Paksha (Dark fortnight) on Wednesday. Moon in - Jyestha constellation. =. . --- ## Page 88 82 Vedic Remedies in Astrology Jyestha is the 18% star counted from Aswini. Thus 18x3 = 54 Birth Ththi is 7* lunar day of dark half = 7+15 = 22 Birth day = Wednesday = 4 Sum = 54+22+4 = 80 Divided by 8, the remainderin , 0/8, indicating Sheena Gandanta or complete destruction. In the horoscope, the Moon is in the ninth houses ruling father and Dharma. The native saw the complete destruction of his fathers business and status within two years of his going abroad for higher studies (ninth house).

Results of birth in different quarters of the constellation causing Gandanta

and happiness (3) Kingly status and respect ` ASLESHA: (1) Kingdom (governor of a territory) (2) Loss of wealth (3) Loss of mother (4) Loss of Father MAGHA: (1) Mother/relatives loss (2) Loss of Father (3) Loss of happiness and wealth (4) Loss of _ wealth JTYESTHA: (1) Lost of eldest brother (2) Loss of younger brother (3) Loss of father (4) Early death. REVATT: (1) kingly status (2) Ministerial status (3) Gain of happiness and wealth (4) Many difficulties 3.3.2.5.5. RIDERS Abhijit Muhurta and good yoga’s obtaining at birth tend to nullify the adverse effect of birth in Gand- anta Female birth in daytime and male birth at night are exempt from Ganda dosha. However, this only reduces the extent of the evil and does not terminate it Chart 3.5 Male born on the 28" of March 1962 at 6:29AM at 22N6, 85E17 --- ## Page 89

Astrological Principles 83

RASH {D-1 Chart) CHART 3-5 NAVAMSA {D-9 Chart) In Chart 3-5, the Moon is in 29°41" in Scorpio in Jyestha ‘Nakshatra (fourth Pada). This is Jyestha Gandanta and since it is 4 Rasi (Moon) Gandanta, there will be danger to the life. The remedial measures were performed and the Par- ents took the child to a Siddhapurusha Swami Mintoo Ma- haraja. On seeing the child the Maharaja observed “ a storm will blow but the child will survive” and gently patted the left eye if the child. In his sixth year while going to school, the bus crashed on the mountain roads and miraculously the child survived. An iron rod had cut his left eyebrow narrowly missing his left eye and his navel was swollen considerably. Yet he survived the storm. The reasons can be seen from the exalted Venus® in Vargottama in the Lagna. from the exalted Venus*® in Vargottama in the Lagna. ¥ Venus rules the Mritunjaya mantra and has the power to give a second life. As the 8% Lord, it showed the danger from vehicle (Venus) accident as it is also placed in the third from the Arudha Lagna in Capricorn. In the natural order of the planets as per weekdays starting from the Sun, Venus rules the sixth year. --- ## Page 90 84 Vedic Remedies in Astrology Maharishi Parasara adds that if the child survives the Gandantaristha® , then he becomes very strong and power- ful and enjoys many Rajyoga. The point is that the Gandanta are akin to Rudra (Shiva/Hanuman) and symbolizes the birth of a powerful individual. They are exceedingly brave and fearless. It is also observed that like Hanumaniji, these persons either stay bachelors/ Brahmachari throughout life or marry at a very late age. Thus, suitable remedial mea- sures will also have to be performed for marriage at a later date for them. Tulsidas the author of Ram Charita Manas was born in Moola Gandanta. He lost his mother in child- birth and his father died in a fire accident occurring within ` 12 days of his birth. Miraculously he survived the fire but was abandoned. He was brought up by monkeys (Hanumaniji) in the outskirts of the village! He was fortu- nate in his Guru and his compositions like the Hanuman Chalisa are considered very auspicious. 3.3.2.5.6. Tithi Gandanta Tithi Gandanta: The junction between Poorna® and Nanda Tithi are called Tithi Gandanta. Here the junction in defined as four Ghatika (two Ghatika in the end of Poorna Tithi and two Ghatika in the beginning of Nanda Tithi). Just like the Rasi and Lagna Gandanta occurred at the junction between two groups of signs having the four Tatwa®, the Tithi Gandanta occurs in the junction of the Tithi when one group of the five elements ends and another begins. Thus, the junction is always between Poorna (5, 10 & 15) Tithi and Nanda (6, 11 & 1) Tithi. These junctions are between Amavasya (K-15) and Sukla-Pratipada (5-1) Panchami and Shasti (5-5 & 9-6 or K-5 & K-6); Dasami & ‘Ekadasi (5-10 & s-11 or K-10 & K-11) and Poornima and ‘Krusna Pratipada (5-15 & K-1). The Gandanta extends for 1° (One Degree) on either side of the junction. This is not a very serious Dosha. However, the remedy lies in worshipping the Luminaries. ॐ Evil of death due to Gandanta Duosha 9 Nanda Tithi are 1, 6 & 11 while Poorna Tithi are 5, 10 &15 in both fortnights 2 Basic elements of Agni (Energy/Light), Prithvi (Solid/ Earth), Vayu {Gas/ Air) and Jala (Liquid/ Water) --- ## Page 91

3.3.2.6. TriDEVA DosHA Trideva refers to Trimurti or the three chief deities Brahma, Vishnu & Shiva. Similarly, Tridevi refers to their spouses Saraswati, Lakshmi & Parvati (Gouri/ Durga) respectively. If a person has three sons, then he is said to be blessed by the Trideva while if he has three daughters, then he is blessed by the Tridevi. The eldest son/daughter has the blessing of Shiva/ Durga respectively, the second of Vishnu/Lakshmi and the third of Brahma/Saraswati. If the native is still dissatisfied and yearns for another child of the opposite sex, it brings the curse of the Trideva or Tridevi respectively. If there is the birth of a daughter after three sons, then the ire of the Trideva is directed to the mother and maternal lineage. Similarly, the birth of a son after three daughters brings the ire of the Tridevi on the father and the paternal lineage. Unless suitable remedial measures are undertaken it could spell doom for the concerned persons and the children suffer. In addition to the remedial measure described below, the four concerned children should worship Shiva/ Vishnu / Brahma/ Indra respectively for the birth of three sons followed by a daughter. If the birth is of three daughters followed by a son, they should worship Durga/Lakshmi/ Saraswati/Santoshi respectively. In fact, the Santoshi Mata Vrata is performed for 16 Fridays by many pious women aspiring for a son after three daughters. However, if after the birth of the son (being blessed by Santoshi Mata}, they are still dissatisfied and have another child (fifth), then the suffering is intense and poverty befalls their lot. The remedial measure for Trideva Dosha is performed on an auspicious day by worshipping Sri Ganesha and the NavaGraha®. On a large plateau of paddy four Kalasha (water pots) are installed with a platform atop. The idols (in gold/ plated) of Brahma, Vishnu, Shiva and Indra are installed on these pots and worshipped. Recitation of the * Nine planets > In the case of birth of son after three daughters, the idols should be of Saraswali, Lakshmi, Durga and Santoshi Mala. ¥ Fire sacrifice --- ## Page 92 86 | Vedic Remedies in Astrology four Rudra Sukta’s and the Shanti Sukta follows. A Yagya® is performed with the Samidha*, Ghee” and 111 seeds with the recitation of the mantra of the deities. After Swastakrita and Poornahuti (Ritual ceremonies), the water from the four kalash is poured on the heads of the parents and child in the ritual called Abhishek. The pooja® ends by giving a donation to the priest (Guru Dakshina) and breaking of fast. [tis important that the child and parents should see the reflection of their faces in the molten Ghee that 15 to be offered at the Yagya. Some social service like distribution of grains /food/ clothes to the needy or ata shrine should . be undertaken 3.3.3. Minor ProBLEMS & CoNCLUSION Minor problems include temporary setbacks in career, marital tensions etc. These have been dealt with in the rel- evant chapters under application of remedial measures. The most important decision that the astrologer has to make is whether to provide short-term solutions to the immediate problem at hand or to aim for the long-term goals of life. There can be no hard and fast rules on this and the spiri- tual development of the astrologer himself has a strong role to play. The general advise is to first aim at the immediate problem and then gradually lead the native to his Ista Devata and other deities to enable his material and spiri- tual development.

3.4.1. DETERMINE THE ISTA & PALANA DEVATA OF THE CHART AS WELL AS THE (GURU AND THE TIMING OF DIKsHA The Atmakaraka is Jupiter, Amatyakaraka is Rahu and Bhratrikaraka is the Moon. The Ista Devata is to be determined from the 129 from Karakamsa i.e. the sign oc- cupied by the Atmakaraka in the Navamsa. In the Navamsa Chart 3.6, AK is in Sagittarius in the ninth house with Mars in the twelfth there from in Scorpio. Thus, Mars determines % Small wood pieces of the Pipal tree. ¥ Clarified butter # Sesamum seeds # Ritual prayer --- ## Page 93

Chart 3.6Female born on 27" July 1964 at 13: 30 AM at Bombay, India. en Rahu Mars Sun CHART 3-6 uL RASI (0-1 Chart} CHART 2-6 NAVAMSA (D-9 Chart) sat Moon (BK) {AmK) Aahu | Mars Sun up (AK) Ven ‘the Ista Devata. Mars can represent the deities Hanuman, Skanda, Chamundi etc. It is well known that during the Vimsottari dasa/antardasa of Jupiter a person has Yoga with the Ista Devata. In the Rasi Chart Mars is placed in a Vayu (Airy) sign in the ninth house with Rahu (Male) and Venus (Female). Rahu has a higher longitude than Venus ‘showing that the masculine attributes will dominate. Thus ‘during the Jupiter Dasa she had visions of Sri Hanumanji Who appeared in her dreams and had detailed discussions regarding spirituality & religion. Hence, it is evident that ‘Mars represents her Ista Devata-Sri Hanuman. The Amatyakaraka is also Rahu placed in the sign Sag- ittarius in Navamsa. The sixth from this sign is Taurus with “Mercury in it. In the Rasi Chart Mercury is in Leo (ruled by --- ## Page 94 88 Vedic Remedies in Astrology the Sun) and is in the first Drekkana. Thus, Mercury repre- senting the Vishnu Avatar will specifically represents the “Sun” Avatar or Sri Ram. She is very much attached to the Holy name of Sri Ram Who will look after her in this life and will guide and protect her. (Palana Devata- Sri Ram). The Guru is to be determined from the Bhratrikaraka of the Chart. Saturn is the Bhratrikaraka and is with the , Moon in the fifth house generating a perfect Kalika Yoga “(Worship of Mother Kali). Thus, her Guru is bound to be- long to the tradition of the Shakti worshippers. With the advent of the Dasa of Saturn, she was bound to move to- wards her Guru and in the Antardasa of Ketu and Pratyantar dasa of Venus, she was given her Guru mantra at the Ramakrishna Mission. Readers may note the influ- ence of the three planets on the fifth and ninth houses. Most important is the rulership of the Mantrapada (25) by Ketu and its placement in the ninth from Jupiter, the natural significator of the spiritual master. The Chart 3-7 for the time of Diksha (initiation into the Guru Mantra) is given below. Chart 3.7 Diksha Mantra 20 September 1997 at 8.30 A.M. at Delhi, India. CHART 3-7 TRANSIT Guru Mantra Diksha The MANTRAPADA (AS) in the Natal Chart is in the sign Scorpio and transit Jupiter aspects this sign by Rasi Drishti. This is an important condition to confirm the timing of the receipt of the Guru Mantra. --- ## Page 95

Increase in spirituality and renunciation etc, are timed from the transit of Ketu (Mokshkarak) in trines to the Arudlia Lagna (AL). The Arudha Lagna of the Natal chart ` (Chart 3.6) is in Aquarius and at the time of initiation into {€ Guru Mantra, Ketu was transiting Aquarius. However, the presence of a malefic Ketu in the fifth house of the Muhurta Chart 3.6 is not good for the mantra as there will "be too many obstacles to its fructification. The best method of correctly predicting the event of Diksha and Guru Yoga is seen from the Drig Dasa. This occurs during the Drig Dasa of the Arudha Lagna or such sign aspecting the Arudhia Lagna. The AL is in Aquarius and the Drig Dasa of Aquarius (See table 3.5) was from July 1994 to July 2003. She was advised by this author to . visit the Ramakrishna Mission and seek her Guru in early - © 1996. However, for one reason or the other the same was . delayed until the advent of the antardasa of Libra (Lagna in the birth chart that aspects the sign Aquarius) in July 1997. The Pratyantar Drig dasa was of Leo, the sign housing the ninth lord Mercury and the Tithi on the date of the Diksha was Krusna Paksha Chaturthi ruled by Mercury.

न न

--- ## Page 96 ॐ गुरवे नम CHAPTER IV MANTRASHASTRA

Mantra Shastra is the science of Mantra. The word ` Mantra is derived! from two words “Mana” or the mind that thinks and “Trai” or to protect. Thus mantra is the science of training the mind to protect the self. As indi- cated earlier, the human being is composed of three entities viz. (1) Atma (Soul) represented by the Sun and Atmakaraka, (2) Mana (Mind including the conscious, ‘sub-conscious and other levels) represented by the Moon and Amatyakaraka and (3) Sareera (Physical - Body) represented by the Lagna Lord* or Devatakaraka Guru. The selection of the deity for these purposes has already been explained earlier. The scope of the science is very vast having three major divisions called Kerala (or Misra), Kashmira (or Satwika) and Ganda (or Vama 1 Source Yaska: Nirukta 7.12 2 Some opine that the Lagna represents the Body, but this is incorrect as the Lagna is only a point in the zodiac without a physical body. The lord of Lagna represents the physical body. Parasara has clearly stated that the Graha (Planets) represent people (animate objects) as they are living and moving around. The signs represent inanimate objects. --- ## Page 97 ` Mantrashastra 91 Marga). 1 covers all religions® and cuts across all castes and creeds. A mantra is a mystical formula composed of letters (or phonemes) and words that is meaningful to the initiated. The création of vac or speech has its origin in the Muladhara Chakra® which is the seat of all creation and is lorded by Ganesha. The desire is from a primal impulse called para-vac or transcendental speech. This desire has to cross the Svadhisthana Chakra (Navel), Manipura Chakra (Solar plexus) and Anghata Chakra (heart) wherein it transforms into Pasyanti and Madhyama to fi- nally reach the Visuddha Chakra (Throat) wherein it takes “the form of audible sound called vaikhari which has been categorized into 50 alphabets® of Sanskrit starting from * (आओ and ending with “ksh” क्ष). Hence the alphabet is called “Akshara The mantra is thus a collection of “akshara” meant to raise the Kundalini Shakti from the Muladhara Chakra to the Visuddha Chakra in the first stage (Bhu Loka) and either with or without a material dbjective in view. In this stage the mantra is recited verbally in a rhythm called Chhanda. Tt gives success in the material world and fulfills material desires as well as all desires re- lated to the Physical Plane of consciousness. In the sec- $ Some authors have tried to restrict this to the most advanced Hinduism, while others have added Buddhism and Jainism, but this is not correct, as there are fine Mantra in Islam and Christianity as well. # Gurupadesatoh Mantra i.e, when the mantra is given by a guru it becomes meaningful. Initiation into a mantra is very beneficial. Ekalavya the unsung warrior in the Mahabharata did not receive the mantra directly from the Guru Dronacharya, yet became proficient in the same. When mantra cannot be taken from the Guru, then prepare an idol of the Rishi {Guru/Sage) of the mantra and worship it. After that the mantra becomes very effective. If the person is alive, then making his idol is prohibited. Ekalavya made this mis- take and ended on the wrong side (Adharma) in the Mahabharata war. Thus, peuple who cannot find a Guru should worship Sage VedaVyasa with the Mantra व्यं च्यासदेवाय नमः (Vyam Vyasadevaya namah) $ One of the Kundalini Chakras at the base of the spine in the form of a Lotus. ¢ These are 49 Akshara from “A” to “Ha” and “Ksha” --- ## Page 98 92 Vedic Remedies in Astrology ond stage (Bhuva Loka), the Mantra is meant to raise the Kundalini shakti from the Muladhara Chakra to the Ajna Chakra (Center of forehead called the third eye) and is repeated silently in a rhythm in the conscious mind. This opens the third eye to super-consciousness whereby the knowledge of the past-present and future are revealed as ‘well as the manifestation of desires of the Mental Plane involved in the mantra. In the third stage (Svah or Swarga ‘Loka), the mantra is meant to raise the Kundalini shakti from the Muladhara Chakra to the Sahasrara Chakra (Situ- ated in the cranium called Brahmarandhra in the form of a white thousand petal lotus). Here the repetition is more of a subconscious habit of the mind and: continues in Transcendental state of meditation or while sleeping in ` the form of Ajapa Jupa. The individual loses the conscious- “ness of the self and is completely unconscious of time and space, yet the mantra continues to lead him towards the penultimate goal (Narayana). These three have been ex- plained by Brihaspati to Indra in the mantra “OM BHUR .BHUVA SVAH”" (ॐ पूभुवः स्व } । 4.1.1. RuLEs The rules for the constitution of a mantra include: - ? Govardhana Parikrama refers to the pilgrimage of going around the Govardhan hill near Vrindavan whereby the pilgrims extol the virtues of Vasudeva Krishna in protecting the devotees from the power of Indra who had sent problems and dangers in the form of thunder showers on the shepherds and devotees Krishna lifted the entire Govardhana hill with His little finger and all men and animals rushed under it for shelter. Indra was incensed with rage and hurled the Vajra (thunderbolt) at Krishna. The Vajra was dissolved in the body: of the Lord of the three worlds (Bhu, Bhuva & Svah) Who then lifted his gaze at Indra . Indra was struck with fear and his body started to ache and break apart. He cried out for the grace of His teacher Brihaspati. Sri Guru Brihaspati chided Indra for this foolish act and for not being able 10 recognize Narayana in the physical form of Krishna and gave the remedy “OM BHUR-BHUVA SVAH” i.e. the recitation of the Ekakshara Mantra (3) in all the there Loka. Indra was cured. Pleased with his devotion, Krishna promised support to his son (Arjuna).. Indra symbolizes the intelligence of a person that is often misled by the Indriya’s (Senses) to start believing in ones immortality. Thus, OM BHUR-BHUVA SVAH refers to the penultimate rulership of God (OM) in the three worlds/ states of existence and the ultimate reality i.e, OM. --- ## Page 99 ` अ 2) . 3)

Mantroddhara or the source/extraction of the Man- tra. Source of a mantra can be in any form. For example, the Kali Karpura Stotra is the source of the Dakshina Kali Mantra or the Madhusudana stotra is the source of the famous Dwadasakshari Mantra (Om Namo Bhagavate Vasudevaya). The source ex- _. plains the import of each and every syllable in the ~ Mantra

` mantra, a) . To attain the Siddha (expertise or mystic power) of the Mantra, this is equal to the number of letters (syllables) in the Mantra in lakhs. For example the Dwadasakshari Mantra (as per its name itself, has 12 akshara or letters. Thus by . repeating it 12 lakh times, the Siddhi of the ` Mantra is attained). . 9) To remove the negative effects of a particular Bhava (House), the mantra is repeated as many thousands of times as the number of the Bhava. For example if one is tormented by diseases, the Mrityunjaya Mantra is prescribed to be repeated 8000 times since the 8" house rules Roga (dis- ease). Similarly, mercury and Jupiter have digbala (directional strength) in the Lagna. Hence during their Antardasa the remedy prescribed is that the thousand names of Vishnu/Shiva® are to be recited €) The Purascharana should be doubled for Sadhya® Mantra and halved for Susiddha Mantra. Samskara or the sacred rituals connected with the Mantra. These rituals could be very elaborate or simple depending on a host of factors. The Mantras * Vishnu Sahasranama for Mercury and Shiva Sahasranama for Jupiter. १ Relationship of the name of the person with the mantra as Siddha, Sedhya, Susiddha or Ari, See 34.1.1 --- ## Page 100 04

Susiddha or Ari, See 34.1.1 --- ## Page 100 04

have definite time of the day for the invocation of ` the deity and the other methods of use of the mantra should be understood from texts like Saradatilaka (Patala IT) etc. Many of the seven crore mantra have some blemish or the other. The performance of the ' ten Samskara (Rituals) removes the blemish thereby making the mantra effective. These Samskara are (i) Janana (Extraction/giving birth): This is the birth ७) ritual of the mantra whereby the Mantra is taken from the Divine Mother as per the canon “Matri bhavo Devata”. Draw the triangular dia- gram with the base in the east and the apex in the west symbolizing Shakti (Divine Mother) (See Kali Yantra Fig 5-12). The letters written inside show the evolution of Akshara’s because of the yoga of Brahma with Bhu Shakti. The Matrika Devi are worshipped in them. While these are elaborate, the simplest mantra is given as under that can be recited with each of the Akshara

lowed by the Letter, then “KLIM SRIM HRIM” followed by “VISHNUSHAKTI-BHYAM NAMAH”, [ॐ हीं ची क्लीं (अ) क्लीं श्री हीं विष्णुशक्तीभ्यां नमः]. In this manner, each syllable of the mantra is replaced in the place of Am(3i) in the afore- said mantra and is repeated 108 times. Thereaf- ter it is written in a Bhurja Patra or a palm leaf (or a neat paper). This is followed by the second syllable in the mantra and so on till all the letters are extracted. Dipana (Kindle): This is the spiritual method of lighting the inner lamp with the Mantra. The १ This is to be replaced by the other letters of the mantra thereby exiracting each from the Shakti Yantra (and other names of Vishnu and Shakti can also be used.) . --- ## Page 101

Mantra to be mastered is prefixed and suffixed with the Hamsa Mantra and recited 1008 times. For example if the mantra “HARE RAMA KRISHNA” is to be mastered, then the Dipana ritual consists of lighting a lamp and reciting the mantra “HAMSA HARE RAMA KRISHNA SO'HAM” (हंस हरे राम कृष्ण सोहम)1008 times. (iii) Bodhana (awaken or enlighten): This ritual is (iv) ४) meant to understand the inner meaning of the mantra. The mantra to be mastered is prefixed «and suffixed with the Beejakshara “HRUM” (ह and repeated five thousand times. For example if the Bodhana of the mantra ‘HARE RAMA KRISHNA is to be performed, then the mantra “HRUM HARE RAMA KRISHNA पारा“ (हू हरे राम कृष्ण हूं) is to be recited 5000 times. Tadana (Striking Power of the Weapon): All mantra are also protective by nature and the weapon carried by the deity of the Mantra is wor- shipped and activated by Tadana. This weapon (Astra (%2)) is prefixed and suffixed to the man- tra and repeated 1008 times. For example if the Tadana of the mantra ‘HARE RAMA KRISHNA’ is to be performed, then the mantra “FHUT HARE RAMA KRISHNA FHUT” (फट हरे राम कृष्ण फट्‌ ) isto be recited 1008 times. Abhisheka (Cleansing/Ritual Bathing): Abhisheka is the process of ritual bathing of the mantra written on the palm leaf using the holy water of the Ganges or other river. The water is “kept in a vessel having a hole at the bottom and drips on the palm leaf bearing the extricated mantra. Since the cleansing has to be done at three levels of the Chaitanya (Our intellect(¥)), --- ## Page 102 96 , Vedic Remedies in Astrology Jeevatma (Our soul(s9)) and Paramatma Yoga (Universal Soul(®)), the three Beejakshara are used. This is the same for each and every man- tra. For example if the Abhisheka of the mantra ‘HARE RAMA KRISHNA’ is to be performed, then the mantra “AIM HAMSA OM” (ए हंस ॐ) is to be recited 1008 times as the holy water drips on the palm leaf. Vimalikarana (Purification): After cleansing, the next step is to prepare the mantra for infu- sion of life force. This is called Vimalikarana and is done with the Beejakshara’s “OM TROM VASAT” prefixed and suffixed to the mantra which is recited 1008 times. For example if the . Vimalikarana of the mantra ‘HARE RAMA KRISHNA’ is to be performed, then the mantra

VASAT TROM OM” (ॐ त्रौ चषट्‌ हरे राम कृष्ण वषट्‌ त्रौ ` ॐ) is to be recited 1008 times. (vii) Jivana (Life infusion): The infusion of life or

. VASAT" prefixed and suffixed to the mantra and repeated 1008 times. For example if the Jivana of the mantra ‘HARE RAMA KRISHNA’ is to be performed, then the mantra “SWADHA VASAT HARE RAMA KRISHNA VASAT SWADHA” (wen awe, हरे राम कृष्ण वषट्‌ स्वदया) 15 to be ` recited 1008 times (viii) Tarpana (Worship/Ritual offering): This is done by Panchamrita Snana (Bathing of the palm leaf bearing the extracted mantra with a mixture of Water, Milk, Ghee!!, Curd and Honey}. The प Clarified butter --- ## Page 103

mantra itself is to be repeated a hundred and eight (108) times as this is offered to the deity. (ix) For example if the Tarpana of the mantra ‘HARE RAMA KRISHNA’ is to be performed, then the mantra “HARE RAMA KRISHNA" (हरे राम कृष्ण) .15 to be recited 108 times as the Panchamrita is , offered to the deity. Others prescribe a mixture of Milk, Ghee and Water only. Gopana (Shielding/Concealing): It is necessary to shield the mantra so that external influences do not weaken its potency. This is done by pre- fixing and suffixing the Maya Beeja (Hrim) to the : mantra and repeating it 1008 times. For example if the Gopana of the mantra ‘HARE RAMA KRISHNA is to be performed, then the mantra “HRIM HARE RAMA KRISHNA HRIM” (हीं हरे , राम कृष्ण हीं) is to be recited 1008 times. ४

tra is made self complete and self dependant or complete in itself by infusing it with the Beejakshara “HSAUH”" (हसौ) that 15 prefixed and suffixed to the mantra and repeating it ` 1008 times. For example if the Apyayana of the mantra "HARE RAMA KRISHNA’ is to be per- formed, then the mantra “HSAUH HARE RAMA KRISHNA HSAUH" (हसो हरे राम कृष्ण हसौ) is to be recited 1008 times. It maybe noted that all the mantras given in the ` “steps (i) to (x) require the mantra to be recited a thousand , times except (i) Janana where each syllable is extricated "by reciting it 108 times, (iii) Bodhana recited 5000 times "and (viii) Tarpana recited 108 times. Devata or the deity of the Mantra. Most mantras have a Devata (literally deity). Devata is derived --- ## Page 104 98 5) 6) 7)

` from the word Diva or light and Devata is the deity or the form in which God accepts the offerings and . guides the worshipper through his material and spiri- tual existence. Chaitanya or the method of infusing the mantra with spiritual energy and power. This is essential as it makes the mantra very effective. Rishi (Nyasa) is the giver of the mantra. As such the . Nyasa consists of placing the five important constitu- ents of the Mantra in five parts of the body. i) The Rishi (sage/seer) is seated on the Siras (head); ii) The Channdah® (Grammatical rendering of the mantra) is seated on the Mukha (face); iii) The Devata (Deity) is seated in the Hridaya (heart); iv) The Begja (Seed syllable or phoneme that led to the revelation/ birth of the mantra) is seated in the Guhya; v) The Shakti (Active power that directs the Karma and also the Ga#® or movement of the individual for the same) of the mantra is seated in the Pada (feet). Anga (Nyasa) or the limbs or body parts of the mantra. The Mantra represents the deity and the parts of the mantra represent the different essential body parts called the Anga in general. This is done in two stages. | 1) First of the six body parts: (a) Hridaya with the word Namah (b) Sirasa with the word Swaha (c) 2 Among the Channdah, the Gayatri is the best. It has 26 syllables in the Mantra and when the monosyllable OM is added to the Mantra the length becomes 27 "(equal to the number of constellations). The others of some importance are Anusthup, Brihat Gayatri etc. गे That is why Adi Sankara sings ^ Gati-stwam Gati-stwam Twam-Eka Bhavani”. --- ## Page 105

Sikhaya with the word Vashat (d) Kavacha with the word Hum (e) Netra with the word Vowshat (f) Astra with the word Fhut. 8 i) The second stage is the Nyasa of the fingers and palm (six parts): (a) Angusthan (Thumb) with the word Namah (b) Tarjanee (Index finger) with the word Swaha (©) Madhyama (Middle finger) with the word Vashat (d) Anamika (Ring finger) with the word Hum (e) Kanishtika (Little finger) with the word Vowshat (0 Karatalakara-Prustha (Palm) with the word Fhut. 8) Sadhana or the penance/practice of the mantra. This will depend on the type of mantra and objective of the individual.

There are at least seventy million Mantra in the Hindu texts. Many of these suffer from some error like Chinnarudha, Visirna etc. Thus it is important to pick a mantra without errors so that the error rectification rites need not be performed. 4.1.2.1. SipDHA MANTRA The mantra can be classified as (a) Pra-siddha Man- tra or those that can be recited by any person irrespective of whether they are given by a Guru or not and without a specific objective of solving a problem or (b) Kamya- ` siddha Mantra which are meant to solve specific prob- lems. While there is an agreement on which mantra belongs to which category, there is some minor disagree- ment on which mantra needs to be given by a Guru. For example there is complete agreement on the Panchakshari Mantra “ नमह शिवाय (Namah Shivaya)” (or its Shadakshari counterpart “ॐ नमः शिवाय (Om Namah Shivaya”) as belonging to the Pra-siddha group whereby anybody can --- ## Page 106 100 । | प्रः Remedies in Astrology . practise it and it is for general well being, but then there are mantra like that of Savitur popularly called the Gayatri Mantra which although meant for general well being and Prasiddha in that sense, needs to be communicated by a competent Guru. ` ` 4.1.2.2, Sex oF MANTRA The mantra can also be classified on the basis of the ending words" that have an effect on the attitude of the ` practitioner. Masculine mantra (PUM) can be identified by their ending syllable/ words like “VASAT” or “FHUT” etc. These have’ the strength to ward off evil and are generally aggressive. Feminine mantra (STRI) on the other hand is docile and generally ends with “SWAHA” or “VAUSHAT" etc. They require the practitioner to be dedi- cated and make offerings to the Deity. Neuter mantra (NAPUMSAKA OR KLIBA) has words like “NAMAH” “HUM” etc, which require the practitioner to submit to the will of the Deity. The choice of a mantra does not depend on the sex of the person as being male or female. The choice would . depend on the attitude that one wishes to invoke the deity with. In general, the mantra for the Ista Devata should preferably be Neuter mantra thereby enabling the person to submit fully and easily to the deity. The mantra for the Palana Karta (6५ from Amatyakaraka) requires that the native be given the energy to fend for himself and near and dear ones in this life. Hence, a Masculine ‘mantra is preferred. The Mantra for Devata Karaka or guru requires an attitude of offering oblations and dedi- cation. Thus, the Feminine mantras are preferred. Capti- vation (Vasikaran), aversion (Ucchatan) and other aggres- sive acts are best done with the aid of PUM (masculine) + Mantramahodadhih (24.92 & 93) Pumstrinapunsakahprokta ` manavastrividhabudhaih, vasadantaphadantasca pumamso manavah- , smrtah. Vaushadswahantaga naryyo humnamoantanapunsakah --- ## Page 107 Mantrashasira ` 101 mantra, while for destruction of diseases and general welfare the STR! (Feminine) mantra are preferred. KLIBA (Neuter) mantras can remove black magic and are very protective

Shorter mantras are to be prescribed initially. Another thing to be noted is that shorter mantra are suitable for younger persons while longer mantra are suitable for elder persons’. However this is very general principle and Mala- mantra like the Gayatri are taught at a very young age as per prescription of the sacred texts. Depending ori the num- ber of akshara (letters or phonemes}, the mantra can be clas- sified as Pinda (One Phoneme), Kartari (Two Phoneme), Beja’ (Three to ten Phoneme), Mantra (Eleven to twenty Phonemes) and Malag-mantra (more thantwenty phonemes). For example, the monosyllable “OM” (ॐ) is a Pinda, the 3 Mantramahodadhih (24.93 & 94) ..Vasyocchalanarodhesu pumamsahsid dhi-dayakah Kshudrakarmarujam nase strimantrahsigrasiddhidah, abhichare smrta kliba evam te manavastridah 1 Mantra Mahodadhih (24.77 & 78) Balye vayasi Siddhyanti Bijamantraupasitah, Mantra Siddha Yauvane tu ` MalamantrascaVaryaddhake Uktanyasyamavasthayamabhistapraptaye Sudhih, ^ Bijamantradimantranaam Dwigunam Japamacharet. Translation: Bijamantra are meant for children and teenagers while Mantras are meant (or middle aged persons. The older generation is prescribed Mala-mantra, Bija Mantra is different from Bijakshara (seed syllable). Bija Mantra is the starting mantra for propitiating a Deity through Mantra-Japa (Repetition). There are various "dictionaries called Bijakshare nighantu that define these Beejakshara or seed syllables that help us to meditate on the deity. These are IM { Vishnu), Kshrount (Mahavishnu), Hrim (Maya or Shakti), Shrim (Rama), Aim (Saraswati), Strim (Tara), Haoum ` (Tryambakeshwar-Shiva), Jum (Driving away disease, evils etc), Hum (Protection), Krim (Kali), Klim (Krishna or Kamabeeja), Hsaum (Power), Blum (Chasing away)

The mantra can also be derived from the first syllable of the name of the deity like Hum for Hanuman, Gam for Ganesha, Dum for Durga, Dam for Dattatreya, Vyam for Vyasadeva ar Vedavyasa etc. The mantra emanating from these Beejakshara take the form of Becjakshara followed by the Name of referring to the deity and then the enwling signifving the relalionship in the form of prostralion (Namah) ctc. For ex- ample the mantra for worshipping Maharishi Vedavyasa will be “VYAM , VYASADEVAYA NAMAH", for Ganesha will be GAM GANAPATAYE NAMAH " , and so on. The beejakshara are also of use in the various Nyasa like Anga Nyasa etc. --- ## Page 108 102 Vedic Remedies in Astrology Holy Name “Krishna” कृष्ण) is a Kartari, the mantra “Hari Om” (हरी ॐ) is a Beeja-Mantra etc. Most authors have opined that Pinda and Kartari are also Begja Mantra. Thus, there are three types': Beeja (1-10 Syllables), Mantra (11-20 Syl- lables) and Mala-Mantra (21 or more syllables). . The mantras are also known by the number of ‘letters they possess. Some famous Prasiddha mantra are the Panchakshari (Five-lettered mantra) “NAMAH SHIVAYA” (नमः शिवाय) which is for general well being OR the Shadakshari (Six lettered mantra for destruction of all ` ` झा) “OM NAMAH SHIVAYA” (ॐ नम शिवाय); Astakshari (Eight lettered Mantra of Narayana for Moksha/emanci- + pation from the cycle of rebirth) “OM NAMO , NARAYANAYA” (ॐ नमो नारायणाय) and the Dwadasakshari (Twelve lettered Mantra of Vasudeva Krishna for enlight- enment) “OM NAMO BHAGAVATE VASUDEVAYA” "(ऊँ नमो भगवते वासुदेवाय) . The number of letters indicate the . house which is being effected by the Mantra. The four Kendra are the seats of Dharma (Lagna called Brahma Gayatri and its trines the fifth and ninth houses), Artha (Tenth house called Vishnu Gayatri and its trines the ‘sixth and ninth houses), Kama (Seventh house called Shiva Gayatri and its trines the third and eleventh houses) :and Moksha (Fourth house called Kali or Tureeya gayatri and its trines the eighth and twelfth houses). The tenth house is also called 5८५1६419 85 the Dasamsa is called Swargamsa. Thus, on the basis of our Karma alone or the mercy of Vishnu can we find a berth at Vaikuntha. Example 1 “Astakshari” : The eighth house is the ` 7 Mantra Mahodadhih (24.75 &76): Beejamantrastathamantra Malamantrastathapare Tridhamantraganah prokta budhairagamavedibhih Beejamantradasarnantastato Mantranakhavadhi Vimsatyadhikavarna Ye Malamantrastu Te Smrtah. Translation: The Sages of the Agama’s have defined the three Manira types of Beeja-mantra, Mantra - and Mala-mantra. Mantras with ten or less syllables are called Beeja-mantra, while those wilh eleven to twenty syllables are called Mantra and those having, more than twenty syllables are called Mala-mantra. --- ## Page 109 ` Mantrashastra : : 103 119 from the tenth and is the HARASTHANA? or de- struction of Karmayoga. This house and its significator - Saturn represents all the sins of past birth and unless we “are absolved of the sins of past lives how can emancipa- "tion from the cycle of rebirth come to happen? Thus Sri 'Ramanujacharya the great Vaishnava gave the Astakshari mantra for emancipation. In this manner, the effect of the mantra on the different houses are to be understood. Example 2 “Janaka Shadakshari”: The sixth house is the house of service and is the trines to the tenth house whereby we serve God and add to the good karma lead- “ing to a berth in Vaikuntha (Heaven). The six lettered mantra given by Janaka Rishi is “HARE RAMA KRISHNA” (हरे राम कृष्ण). Now, the second house rules eyes and the tenth controls the eyes being the ninth there ` from. Thus the tenth and its trines signify the three eyes (right eye-Sun, left eye-Moon and Third eye in the center of the forehead-Jupiter). Jupiter is worshipped with the Akash Beejakshara “Ha” (ह) and Agni Beejakshara “Ra” (र) combining to give the mantra “HARA” , “HARI” or “HARE” depending on whether the focus is on the 7, 1१ =. or 10% house respectively. Maharishi Parasara has taught that Sri Rama is the Surya (Sun) Avatar and Sri Krishna ` ` is the Chandra (Moon) Avatar of Vishnu. Hence, the ` mantra for opening the three eyes and worshipping Vishnu . for guiding the eyes in the correct path of Karma Yoga is “HARE RAMA KRISHNA”. Being six lettered, it makes the mind to focus on good Karma and the eyes and intelligence to be directed to the same. Being the 11* from the 8* house, this mantra urges one to do good Karma ` thereby destroying or enveloping the bad Karma/ sins of ` the past. The difference between this and the Astakshari maybe noted as the latter is a prayer to God (Narayana) for forgiveness and deliverance. ¥ Heaven or Valkuntiha ॐ “Tanoutana Danda Hara” Jaimini's Upadesa Sutra थे See Para 3.3.2.3. The mantra has six letters and is within the range of 10 syllables, Readers may note that the Dwadasakshari (12 syllable mantra) is not a Beeja-mantra. ` ` --- ## Page 110 104 ` ` Vedic Remedies in Astrology

The Shadakshari is a Beejamantra® or one that leads to a higher mantra. Let us attempt to derive a Malamantra that can be sung all the time from this Beejamantra. If we do not change the three words, we have “HARE” “RAMA” & “KRISHNA”. Thus the number of words for the Malamantra is given by the formula: =n(12+1)+w where “W” is the total number of words in the Malamantra; “n” is any integer and “w” is the number of letters in the Beeja-mantra. Thus, with “w"=3 and “n"=1, we have “W"=16. Hence we have the 16 word 32 syllable? Mahamantra.

HARE

(हरे कृष्ण हरे कृष्ण कृष्ण कृष्ण हरे हरे हरे राम हरे राम राम राक हरे ह) 4.1.2.5, SOLAR/LUNAR MANTRA. Mantras containing the fire syllables are called Saura (Sun) or Agneya (Fire/ Energy). If they do not contain the fire syllables Om? (ॐ), Ha (ह) and Ra (२) are called य We can also use the formula L=N(12+1)+] to derive the syllables. Using 1=6 and N=2, we get 32 as the number of syllables of the Mahamantra. B Om (ॐ) is the Ekakshara or one-lettered mantra répresenting divinity. It is composed of three letters “A” (Brahma), “U” (Vishnu) and “M” (Shiva) and represents the entire life process of birth, sustenance and death. Since it repre- sents God in all the three aspects, it is also the Trimurti (Dattalreya Mantra). Hence it becomes the Guru of all Mantras meant for achieving Yoga with God. These three letters also represent the three Guna (Satwa, Rajas & Tamas), the three Rishi (Narada, Agastya & Doorvasa), the three levels of the body (Na- vel, Heart and Head) etc. For a fuller understanding, a reading of the SrMap BHAGAVATAM translated by Srila Prabhupada is recommended to be followed by the Kena UpaNistap and the Ric VEDa. Several mantra starl with OM on the basis of the teachings of the Rig Veda in the following Mantra गणानां त्या गणपतिं हवामहे कवि करवीनामुपगश्रवस्तमम्‌ । जयेष्ठराजं SET बरस्मणस्पत आ नः श्रणवनूतिभिः सदि सादनम्‌ । | Gananaam Twa Ganapatim Havamahey; Kavi Kavinam Upavasra- vastamam; Jyestha-Rajam Brahmanaam Brahmanaspata Aa Nah

O Ganesha, Lord of all seers, praise be to Thee: Thou art Omniscient and the unmatched wisdom of the wise. Thou art the precursor [OM {}] of all the prayers and the Lord of all souls; we pray for Thy guidance for success in all goad actions. [Translation] --- ## Page 111 Mantrashastra 105 Chandra/Saumya (Lunar) mantra. Saura mantra are said ` 10 be effective during the day while the Saumya Mantra are more effective at night. However, in actual practice, this is not correct as there are many mantras starting with OM that have to be recited only at nighttime. Thus, this differentia only checks for the presence of the fire element (symbolizing the soul) in the mantra

The suitability of a mantra should be judged before giving it, else the consequences can be negative or disas- trous depending on the extent on unsuitability. This is tested based on the name? and the Varna® (profession) of the Sadhaka®. This is done in a few stages. Firstly we need to check the starting letter of the Mantra. This is followed by a check on the total number of letters of the: Mantra. The third step is to check the overall impact of all the letters of the Mantra 421. First LETTER SUITABILITY 4.21.1. AKATHAHA CHAKRA Draw a table with five vertical and horizontal lines to have four rows and four columns (See Table 3.4) and place the letters in them. The blocks are numbered in the regular manner. The placement of the letters is on the basis of the block numbers in the following order: 1, 3,11, 9, 2, 4, 12, 10, 6, 8, 16, 14, 5, 7, 15, 13. Now determine the block having the Name Letter and the Block having > Names were based on Janma Rasi, but the system is not strictly followed. Hence, the stronger of the two of Janma Rasi (Moon sign at birth) and Nama Rasi (Sign having the Name letter) should be selected or both. > Since Varnashrama (the social system of following the profession on the basis of the caste) is hardly existent today, his should be based on the predomi- nant Guna or the nature of the dominant sign determining nature from the horoscope. The Fiery signs are Kshatriya, the watery signs Brahman, the Airy signs Vaishya and the Earthy signs Sudra. ॐ Person taking the mantra for practise. --- ## Page 112 106 Vedic Remedies in Astrology _ the first letter of the Mantra (In case the Mantra starts with Om (ॐ), then the next letter is to be used).

| ^ ° | 1अकथह 23F97 9ञआखद्‌ A KaTha Ha | Uo Am Pa | Aa Kha Da 5ओडव 6TH 73 eo 8लजय 0 Dah Va Lri Jha Ma | Oo Dhha Sha | Lree Nya Ya 10 FE SAY 1WsTYH 12 त्व Ee Gha Na Ree Ja Bha | E Ga Dha Re Chha Ba 1४ @Bamagd 18 ऐठल [15377 , |16.एटर Ah Ta Sa Aai Ttha La | Am Una Ssa | Aye Tta Ra It is always advisable to write the name using ` Devanagari script so that errors do not occur. The blocks containing the first letter of the name and the first letter of the Mantra should be determined. These are called the name block and the Mantra block respectively. Count the number of Rows and Columns from the Name Block to the Mantra Block. On the basis of the rows, the following delineation is made: 479%

a) The four blocks in the same row as the name block are called Siddha Chatustaya. The four blocks in the second row (counting down- wards in the order of I, 1I, III & IV) are called Sadhya Chatustaya. The four blocks in the third row from the name ` ¥ Named on the basis of the letters in the first block i.e. “A” “Ka” “Tha” & " Ha”. ॥ --- ## Page 113 ` Mantrashastra ) । 107 block are called SuSiddha Chatustaya. The four blocks in the fourth row from the name block are called Ari Chatustaya. Ari is another word for Satru or enemy Similarly, counting the columns from the Name block to the Mantra block we have the four of Siddha, Sadhya, ` ५४51५009 and Ari depending on whether the name block is in the first, second, third or fourth column respectively. In this manner, we can sixteen combinations on the basis of the Row & Column relationship between the blocks. These are referred to as “Row relationship”-“Column relationship” like Siddha- Susiddha or Sadhya-Ari etc. The results of these are given in table 3.5. Table 4.2 Akathaha Relationship results RELATIONS RESULTS (Row | | Mantra fructifies after prescribed Japa (Repetitions /Chant)

Sidhe - [ Susiddha | Mantra fructifies after half the number prescribed for - - 1 chanting. Siddha | Ari Destroys immediate family members like son etc.

Manira fructifies after half the number prescribed for chanting. Mantra fructifies after double the prescribed number of chanting, Mere initiation is enough for the mantra to fructif Destroys fainily members Destroys the son(s) Destroys the daughter(s) Susiddha | Destroys spouse Ari Destroys the native himself. Example 1: Let us determine the suitability of the Chamundi Mantra for a person named Kailash. The ` Mantra for worshipping Durga in the Chamundi form is (५८ | Sadhya Susiddha | Susiddha | Ari --- ## Page 114 108 ` Vedic Remedies in Astrology ~ “OM AIM HRIM KLIM CHAMUNDAYAI VICHCHAI” ॐ ए ढ़ क्ती चामुण्डायै वीचै). Thus the first letter of the name is “Ka” (को and the name block 15 Al (see table 3.4). Simi- larly, the first letter of the Mantra (excluding the common starting syllable Om) is “Aai” (ऐ) and the mantra block is BIV. Counting the Rows from name block (I} to mantra block 0४) we get four and the relationship is “Ari” or: enemy. Counting the columns from name block (A) to mantra block (B) we get two and the relationship is “Sadhya”, Thus the overall relationship 15 Ari-Sadhya and table 3.5 gives the result as destruction of daughters. Hence, this mantra should not be used by the person. It maybe noted that we have used the letter of the name itself instead of the birth chart. Example 2: Let us determine the suitability of the ‘Tantrik mantra for Jupiter for a person named Ravi hav- ing Tula Rasi. The tantrik mantra for Jupiter is “OM GRAM GRIM GRAUM SAH GURAVE NAMAH” (ऊ mi मीं ` गौ सः गुवे नम). The first letter of the name is “Ra” (र) (for the Moon sign as well) and the name block is DIV. The first letter of the mantra (after OM) is “Ga” () and the mantra block is CIIL Counting from the name block row (D) to the mantra block row (c) we get four and the relationship is Ari or enemy. Counting from the name block column (IV) to the mantra block column (1) we get four and the relationship is Ari (enemy). Thus the overall relationship is Ari-Ari. The result for this as per table 3.5 is destruc- tion of the native himself. Hence, this mantra should not be given to Ravi. Inference (1): All the letters in the fourth row and fourth colin from the name block should be rejected while selecting a mantra. Example 3: In the example 1 above, we find that the Janma Rasi of the person named Kailash is Leo and that ‘the name letter as per the constellation of the Moon is “Ma” (भ). Then the name block 15 BII instead. The --- ## Page 115 Mantrashastra . 109 Chamundi mantra starts with “Aai” (¥) and the mantra + block is BIV. Counting the Rows from name block (II) to mantra block (IV) we get three and the relationship is -“Susiddha”. Counting the columns from name block (B) "to mantra block (B) we get one and the relationship is . “Siddha”. Thus the overall relationship is Susiddha- Siddha and table 3.5 gives the result as mantra fructifies after half the number prescribed for chanting. Thus the mantra is very favourable. Inference (2): If the birth chart is available, then the name letter as indicated by the Nakshatra-Pada of the Moon should be used instead of the name of the person. In case of doubt, the Moon position at Prasua time should be used to decide.

AKADAMA CHAKRA is an alternative method of testing the Siddhadi suitability of the first letter of the name and the mantra. However, this method is not rec- ommended as it ignores the four neuter letters Lri, Lree, Ri & Ree (& क ऋ ऋ) thereby reducing. the number of Suryakshara (Vowels ruled by the Sun) from 16 to 12. The problem arises when a name like “Rishi” comes up ` and then this Chakra is inapplicable. Some recent au- thors have advised the use of this Chakra to determine the efficacy of usage like “Ucchatan”, “Maran” etc, but this Chakra does not have the sanction for such a use.

The twenty seven Nakshatra (constellation) are di- vided into three groups of nine each starting from the constellation having the first letter of the name. This ` ‘group of three constellations in trines to the name” ‘constellation is called Janma, the second-Sampat, third- ॐ» This assumes that the constellation bearing the first letter of the name is also the birth Moon constellation. If not, then the Moon constellation be used. lf the birth data is unknown, then the name constellation be used. --- ## Page 116 110 Co "Vedic Remedies in Astrology ‘Vipad, fourth-Kshema, fifth-Pratyari, sixth-Sadhaka, sev- ‘enth-Vadha, eighth-Mitra and ninth-ParamMitra. Avoid ‘mantra where the starting letter belongs to a constellation that is Vipad (Third-Problems), Pratyari (Fifth-Sworn enemy) and Vadha (Seventh-obstacles). Some authors? have given a different set of letters for different constel- ‘lations, but the standard letters used in Vedic Astrology are recommended.

The total number of letters (Akshara) In the mantra . 15 added to the number of letters in the name® of the . person. This sum is divided by four. Following results should be declared If the remainder is One (1) the Mantra is said to be Siddha (Can yield results after completing the nor- mally prescribed number of chanting), If the remainder is two (2) the Mantra is Sadhya (Can yield results after double the normally pre- ‘scribed number of chanting), If the remainder is three (3) Susiddha (Can yield results after half the normally prescribed number of chanting and If the remainder is 0 or 4 Ari (Opposite and evil results) Example 4: Let us determine the suitability of the ~ Panchakshari Mantra for a person named “Kailash”. The Panchakshari (Five-lettered mantra) is “NAMAH SHIVAYA” (नमः शिवायो and has five letters (excluding Matra’s) and the name “Kailash” (केलाश) has three letters. The total number of letters in the name and the mantra २ Mantramahodadhih (24.28.31) ॐ The name refers to the Indivedual or what is called the first name of the person and does not include the family name or Surname of the person. --- ## Page 117 Mantrashastra | 111 is eight (5+3=8). Now, dividing this sum (8) by 4, we get ‘a remainder of zero(0). The results ascribed for this is Ari (enemy) and should be rejected. Example 5: Check the suitability of the Astakshari ‘Mantra for a person named Zoran. The name Zoran (जानी) has three letters (complete Akshara). The Astakshari ‘(Eight lettered Mantra of Narayana for Moksha/emanci- ‘pation from the cycle of rebirth) “OM NAMO NARAYANAYA” (ॐ नमो नारायणाय) has eight complete let- ters in the Devanagari script. Thus, the sum of the two is eleven (8+3=11). Dividing the sum(11) by 4 we get the remainder three (3). Hence, the Mantra is Susiddha and will yield the desired results very early. Example 6: Check the suitability of the mantra for ` Mother Mary for a lady named Leela. The mantra for Mother Mary is “Ave Maria” (अवे मारीया) and it has five complete letters. The name Leela (लीला) has two complete letters. Hence the sum of the number of letters of both the mantra and name is seven (5+2=7). Dividing this by four ` (4) we get a remainder of three (3) indicating the result to be Susiddha and yielding fruits very early

ॐ The name refers to the Indivedual or what is called the first name of the person and does not include the family name or Surname of the person. --- ## Page 117 Mantrashastra | 111 is eight (5+3=8). Now, dividing this sum (8) by 4, we get ‘a remainder of zero(0). The results ascribed for this is Ari (enemy) and should be rejected. Example 5: Check the suitability of the Astakshari ‘Mantra for a person named Zoran. The name Zoran (जानी) has three letters (complete Akshara). The Astakshari ‘(Eight lettered Mantra of Narayana for Moksha/emanci- ‘pation from the cycle of rebirth) “OM NAMO NARAYANAYA” (ॐ नमो नारायणाय) has eight complete let- ters in the Devanagari script. Thus, the sum of the two is eleven (8+3=11). Dividing the sum(11) by 4 we get the remainder three (3). Hence, the Mantra is Susiddha and will yield the desired results very early. Example 6: Check the suitability of the mantra for ` Mother Mary for a lady named Leela. The mantra for Mother Mary is “Ave Maria” (अवे मारीया) and it has five complete letters. The name Leela (लीला) has two complete letters. Hence the sum of the number of letters of both the mantra and name is seven (5+2=7). Dividing this by four ` (4) we get a remainder of three (3) indicating the result to be Susiddha and yielding fruits very early

The sequence of letters in the mantra is to be com- pared to that of the sequence of letters in the name of the person to determine the number of letters in consonance - with that of the name. If the letters of the name are more, then only the letters in the beginning of the name equal ‘to the letters in the mantra are to be considered. If the Jetters in the mantra are more than that in the name, ‘then the letters in the name should be repeated as many ‘times as necessary. Count from the first letter of the name to the first letter of the mantra as per the sequence of alphabets in --- ## Page 118 112 Vedic Remedies in Astrology the Devanagari® script. Divide the number by four. Fol- lowing results should be declared: If the remainder is One (1) the Mantra is said to be Siddha (Can yield results after completing the nor- mally prescribed number of chanting) If the remainder is two (2) the Mantra is Sadhya (Can yield results after double the normally pre- scribed number of chanting) “If the remainder is three (3) Susiddha (Can yield results after half the normally prescribed number of chanting and, If the remainder is 0 or 4 Ari {Opposite and evil results). Similarly, count from the second letter of the name to the second letter of the mantra, the third letter of the name to the third letter of the mantra and so on. For the purpose of this method, “Om” occurring at the beginning of a mantra should also be taken as the first syllable/. letter. Siddha and Susiddha are very desirable, whereas Sadhya is not bad. Ari is definitely negative. The easier method is to ensure that the number of Siddha and Susiddha exceeds the number of Sadhya and Ari. How- ever, we can have a grade system whereby we give 1 Point for Siddha, 2 Points for Susiddha, 0 Points for Sadhya and -1 (Negative) Point for Ari. Then, if the result is positive, the mantra can be prescribed. To enable simplicity in counting, the letters of the Devanagri Script maybe written in four squares in the clockwise manner (Table 3.6 Siddhadi-sodhana Chakra). Some authors consider this as a separate method itself ॐ Also called Nagari script and is the script of the Hindi Language as well. A working knowledge of Hindi or Sanskrit is essential for this purpose. Further, all 65 Akshara of the Sanskrit script as indicaled in the table3.4 of the Akathaha Chakra are to be used. --- ## Page 119 Mantrashastra ॥ 113 because of the name, but this view is not correct as the Akathaha Chakra has already been given for comparing only the first letters of the name and the Mantra. This Siddhadisodhana Chakra is meant for comparing the sequential relationship of letters of the name and that of the mantra.

lla Aa Kha Da पाए Cha Fa Oo Dhha Sha Lree Nya Ya अकथधहउडपओडवलझम A Ka Tha Ha Uo Am Pa 0 Dah Va Lri Jha Ma TTR BIJNAT ET E Ga Dha Re Chha BaAm Una Ssa Aye Tta Ra Ig TEAM AILSA Ee Gha Na Ree Ja Bha Ah Ta Sa Aai Ttha La Example 7: Let us determine the suitability of the mantra “Hari Om” (हरी ॐ} for a person named Ramanujam (TA). The mantra has three letters whereas the name has more. Hence only the first three letters of the name are to be considered. The name and mantra letters are to be compared as per table 4.4. Two letters of the name have attained a Susiddha relationship with that of the mantra while the third has a Siddha relationship. This makes 5 Positive points and the mantra is very suitable. R

I | म | Mair | बा 12 I Example 8: Determine the suitability of the Janaka | nN Jy --- ## Page 120 114 : - Vedic Remedies in Astrology Shadakshara (six lettered mantra given by Janaka Rishi is “HARE RAMA KRISHNA” (हरे राम कृष्ण)) for a person named Sanjay (संजय). The mantra has six letters whereas the name has three letters indicating that it has to be written twice. The comparative statement is at table 3.8 wherein the Susiddha has occurred thrice, Sadhya twice and Ari once. The net points is 5 positive and the mantra is allowed. This is merely an example for explaining the mathematical computation. However, as per tradition® there is no need to test the suitability of the mantras for Sri Krishna (This is the ONLY EXCEPTION)

Name

2 (202 (43 43 ॐ | म 2129110 Sadi Sadhya | Susiddha Points Points 4.2.4, RNa-DHANAY Rna-Dhana is the method of determining the efficacy of a mantra. By the mathematical tools it has to be ascertained whether the mantra or the person (using Name} is in debt. If the mantra is in debt, then it implies that the mantra is going to give good results due to the good karma of the past. If the person is in debt, then the sins are still weighing heavily and a lot of additional effort like double the number of repetitions, has to be made to make the mantra effective. It maybe noted that 5 Brihad Gautamijya Transliteration: “ Siddha-Sadhya-SusiddhAri Rupa Natra Vicarana” "Translation :There is no need to consider the Siddha-Sadhya-Susiddha & Ari relationships {in a mantra for Sri Krishna). % Lit. Rna means debt and Dhana means money. Hence Rna-Dhana is a math- ematical tool for determining the efficacy of a Mantra. It is something akin to “Debt-Equity” in economics. --- ## Page 121 Mantrashastra हर 115 this method does not reject mantra even if it is Dhani (Richer) than the name, which 15 Rni (In debt). The three methods for estimating Rna-Dhana are being described hereunder. 4.24.1, RNa-DHana CHAKRA Table 4.6 gives the Rna-Dhana Chakra which is to be used to determine the values for the Mantra and Name (of the person) separately. The Akshara compris- ing the Mantra/ Name are separated and their numerical value ascertained from the table 3.9. Thereafter, the num- bers are added and’the sum is divided by eight (8). The remainder is the net value of the mantra/name. The numerical values for the letters of the mantra correspond to the ones in the top row whereas the numerical values for the letters of the Name correspond to the ones in the bottom row. In the case of the longer vowels, the numeri- cal values of the corresponding shorter vowels should be taken. Now, if the net value of the Mantra is higher than that of the name, then it is Rni (In debt) and the person (name) is Dhani (rich). This is auspicious whereas if the net value of the name is more than the mantra, then the person (name) is in debt (Rni). If both are equal, then also the person (name) is not in debt and the mantra fructi- fies. Further, all the letters including semi-vowels, vowels etc. have to be considered.

--- ## Page 122 116 Vedic Remedies in Astrology Example 9: Examine the Rna-Dhana of a person named “Sanjay” (saMjaya) for reciting the Baudhayana Rudra Mantra. The ten syllable mantra for worshiping ~ Sri Rudra as given by Rishi Baudhayana is OM NAMAH BHAGAVATE RUDRAYA (ॐ नमः भगवते स्द्राय ). This mantra is very effective during the periods of Mars (Rudra) in the tenth house (Ten syllable). The name has four Akshara (including semi-letters). These are Sa (@)=1; Am(3)=1; [०9(ज) 5; (य) =4. The values of the alphabets have been taken from the last row of table 4.6. The sum of all four is 11 (1+1+5+4=11). Dividing the sum by 8 we have a remainder of 3. Thus, the net value of the name is three (3). The mantra has fifteen Akshara (including semi- _ letters). These are Oo{3)=3; Am(31)=8; Na(7)=5; Ma(q)=2; AH(sr)=9; Bha(w)=27; Ga(m)=2; Va(7)=2; 10 (तौ-15; Ai(Q)=6; Ra(9=15; Uu(3)=2; Da(2)=4; Ra(7)=15; Aa(3)=14 Ya(m)=12. The values of the alphabets have been taken from the first row of table 4.6. The sum of all fifteen is 135 (3+8+5+2+9+27+2+2+15+6+15+2+4+15+14+12=135). Dividing the sum by 8 we have a remainder of 7. Thus, the net value of the mantra is seven (7). Since the net value of the mantra is higher than that of the name, the mantra is Rni (in debt) and will fructify quite fast. Inference: A good mantra can be defined as one with a high net value so that it can be adopted by a large number of persons and can be easily beneficial for them, 4.2.4.2. Rna-DHANA oF FirsT LETTER This method ascertains the Rna-Dhana based on the first letter of the name and that of the mantra. Count the Akshara (alphabets) from the first letter of the name to the first letter of the mantra. Multiply the result by three (3) and divide by seven (7). The remainder is the net --- ## Page 123 ` Mantrashastra 117 value of the name. Similarly, count the Akshara (alpha- bets} from the first letter of the mantra to the first letter of the name. Multiply the result by three (3) and divide by seven (7). The remainder is the net value of the man- tra. Again, if the net value of the Mantra is higher than that of the name, then it is Rni (In debt) and the person (name) is Dhani (rich). This is auspicious whereas if the net value of the name is more than the mantra, then the person (name) is in debt (राप). If both are equal, then also the person (name) is not in debt and the mantra fructifies. : Example 10: Examine the Starting letter Rna-Dhana of a person named “Sanjay” (संजय) for reciting the Baudhayana Rudra Mantra (ॐ नमः भगवते रूद्वाय). The first Akshara of the name is Sa (स) and that of the mantra is Oo (ओ). Name Value: Counting from Sa (स) to Oo (ओ) both inclusive, we get 16 akshara (that includes Ksha (क्ष) after Ha(z)). Now this number multiplied by three gives 48 (16x3=48) and dividing by 7 we have the remainder of six (6) which is the net value of the name. Similarly, count from Oo (ओ) to Sa (स) to determine the Mantra value. This count yields 36. Multiply this by 3 (36x3=108) and divide by 7. The remainder is three (3) which is the net value of the mantra. Thus, the starting letter of the mantra has a lower net value than the starting letter of the name thereby making the name Rni (in debt) and indicating that the mantra has to be recited many more times to yield fruits.

Determine all the Akshara (including the semi letters i.e. all vowels, semi-vowels and consonants) in the Man- tra and the Name separately. To determine the net value of the name, multiply its total letters by two (2) and to this add the letters of the Mantra. Divide the sum by --- ## Page 124 118 ः Vedic Remedies in Astrology eight (8). The remainder gives the net value of the name. Similarly, to obtain the net value of the mantra, multiply its total letters by two {2} and to this add the letters of the Name. Divide the sum by eight (8). The remainder gives the net value of the Mantra. If the net value of the Mantra is higher than that of the name, then it is Rni- (In debt) and the person (name) is Dhani (rich). This is aus- picious whereas if the net value of the name is more than . the mantra, then the person (name) is in debt (Rui). If both are equal, then also the person (name) is not in debt "and the mantra fructifies. Example 11: Examine the Rna-Dhana of a person ‘named “Sanjay” (संजय) for reciting the Baudhayana Rudra Mantra i.e. OM NAMAH BHAGAVATE RUDRAYA (ॐ नमः भगवते सद्राय). The name has four (4) Akshara (including semi- letters). These are Sa (स), ता (अं, Ja(¥)), Ya(3). The mantra has sixteen (16) Akshara (including semi-letters). These are 0(ओ); Am(3i); Na); Ma(®); Oo(3r); Bha(¥);, Ga(m=2; Va(3@); Tad); Ai(®=6; २०(र); Uu(3); Da); Ray); ^ (अ); ` Ya(@). Now to determine the net value of the name, its letters (4) are multiplied by two (2) to get eight (4x2=8). The number of letters of the mantra is added to this (8+16=24) to get 24. This is now divided by 8 and the remainder is 0. Thus, the net value of the name is 0. : Similarly, to get the net value of the mantra, its letters are multiplied by 2 and the letters of the name are added to “it to get 34 (16x2+4=36). This is divided by 8 to get the remainder of 4. Thus, the net value of the mantra is 4. Since the mantra has a higher net value, it is Rui (in ` debt). 4244, Rna-DuHana CONCLUSION ` The first method to determine the Rna-Dhana using the Chakra is the most sound method. The others merely 1) --- ## Page 125 Mantrashastra 119 give the suitability of the first letter and the total letters. ` 171 case the suitability is not good, then by performing the ‘Mantra Samskara this is removed and the mantra be- comes suitable. However, there is no need to test the Rna- Dhana of any mantra for Sri Krishna. 4.25. MANTRAS EXEMPT FROM THE ABOVE TESTS Although texts have given different lists of mantras exempt from the above tests, only the Pra-siddha mantras and those given in the Holy Rig Veda (Mala Mantra as these are Gayatri etc.) can be exempted from the tests. - As explained earlier, the mantras of Sri Krishna are also exempt from these tests. For the convenience of readers a list of some mantras exempt from the tests is being given here: - 1) OM NAMO NARAYANAYA 2) OM NAMAH SHIVAYA 3) OM TAT SAT हि 4) GAYATRI MANTRA'S OF RIG VEDA 5) OM NAMO BHAGAVATE VASUDEVAYA 6) HARE RAMA KRISHNA 7) MAHAMANTRA ETC. 4.2.6. UNDOING A WRONG MANTRA If out of ignorance an incorrect/ Ari (Enemy) mantra has been practiced for some time, then it should be dis- carded immediately. This is done by worshipping the ` deity of the mantra by reciting the mantra in the reverse order 1008 times. A water vessel is placed on the Sarvatobhadra Mandala and consecrated with the favor- 3 Trailokya Sammohana Tantra: “Na Catra Satrava Dosha narnasvadi vicharana, Rksha rasi vicharo va na kartavyo manau priye”. --- ## Page 126 120

ite items of the deity. The deity is worshipped inside the pot. Then a Yagya (fire sacrifice) is performed with 108 oblations of ghee etc. Finally, the following prayer is made as the mantra is written in the reverse order of its syllables on a palm leaf: Mantra Transliteration Translation आनुकूल्यमनालोच्य मया तरलबुद्धिना । | SEU पूजितं च पभो मन्रस्वशूपकम्‌ | तेन मे मनसः क्षोभमशेषं विनिवर्तय । । पापं पतिहतं चास्तु भूयाच्छेयः सनातनम्‌ | तनोतु मम कल्याणं पावनी भक्तिरस्तु ते । । Anukulyamanalochya maya taralabuddhina

Mantraswarupakam, . Tena me manasah Kshobhamashesham Vinivariaya -Papam pratihatam castu bhuyacchreyah sanatariam - Tanoutu Mama kalyanam pavani bhaktirastu te. Without considering its suitability 1 have (erroneously) worshipped (You, the De- ity) with this Mantra. This has agitated “my mind and it is prayed that the evils of , ऽ wrong doing be eradicated. May ‘the sins be washed away and welfare and prosperity accrue with this sanctify- ing (prayer) devotion. Thereafter the palm leaf is tied on the head and the water in the pot is poured on the head. Again, the palm leaf is untied and placed inside the pot that is filled with water and is thrown in a river/pond etc. --- ## Page 127 \ ` \' Mantrashastra , 121 ५

The adept at Mantra Shastra® can minutely alter a . Mantra to suit the person provided other mantras are 2150 not suitable or he is unable to obtain another. This is done in two ways a) By adding either one or more of the three Beejakshara of Hrim(&), पापा (कली) or Srim(s¥) to the mantra as a prefix. For example if the Mantra “Suryaya Namah” (सूयीय नमः) is not suitable for some person named Pawan [Ari-Ari], then by adding the syllable Hrim (हीं), the mantra becomes Hrim Suryaya Namah(& सूर्याय नम) and the relationship is [Siddha-Ari] i.e. slightly better but still with problems. Then the second alternative Srim(f) can be tried as “Srim Suryaya namah” (श्री सूयीय नमः) and the relationship becomes Sadhya-Sadhya and is acceptable. OR b Nova’ By adding OM(#) at the beginning and end of the mantra (i.e both prefix and suffix) thereby the mantra becomes “enclosed” and the defect is re- moved. In the above example, the mantra can then become “Om Suryaya Namah Om ... (ऊँ सूयीय नमः ॐ) OR ©) Performing the recitation in the regular and re- verse order of the syllables. In the above example, first recite the mantra as “Suryaya namah” (सूर्याय नमः) and then as “Mana Yaryasu” (मन amg), OR d) Faith can move mountains. If the person has un- dying faith in a mantra, then even if it belongs to oe the group called Ari (Enemy) and has all the flaws, it will still fructify. There can be no substi- tute for this faith. All the Shastra etc. fail in front of His Mercy (Divine Grace). ॐ The science of Mantra --- ## Page 128 122 | Vedic Remedies in Astrology 4,28. KuLaA-KuLa Kula means family or lineage and in the case of the Mantra, the family tree can be on the basis of the five elements/ states of existence as Agni (Light/Energy), Vayu (Gas/ Air), Jala (Water including all fluids), Prithvi (Earth including all solids) and Akash (Ether that exists in Vacuum as well). All the letters of an element are said to belong to one Kula or family and are naturally benevolent to each other. Similarly, some families are friendly to others and inimical to some others. It is important that the . starting, letter of the mantra is not inimical to that of the name. The columns in Table 4.7 give the five families. The relationship between families is at Table 4.8. The planets have been shown for additional information and are as . per Parasara. Their ownership of letters/ Akshara is along the rows indicated. The Sun owns the vowels, the Moon the semi-vowels and so on. The results of the Kulaa-Kula relations are to be deciphered as follows: «If the starting Akshara of the Mantra belongs to the same family as that of the name, excellent results are obtained. «If the starting Akshara of the Mantra belongs to a ‘friendly family as that of the name, good results are obtained. * If the starting Akshara of the Mantra belongs to a ` neutral family as that of the name, no results are obtained. « If the starting Akshara of the Mantra belongs to an inimical family as that of the name, adverse results like disease and death are obtained. Example 12: Suppose “Sanjay” wants to adopt the Mantra “Hare Rama Krishna”, we ascertain the starting letters of the name as Sa(d)-Water and that of the mantra --- ## Page 129 | ख | ग Element Friends Vayu (Wind Agni (Fire) Akash (Ether

~ Table 4.7 Kulaa-Kula Chakra ` ~ `: Enemy | Prithvi (Earth i DIISPYSDLIUBIN घटा. --- ## Page 130 124 Vedic Remedies in Astrology as Ha(g)-Ether. Since the Akshara of the Mantra is in the ~ Ether family, it is friendly to all and anybody can adopt this mantra. Inference: All Prasiddha mantra meant for the Public usage should always be starting with a letter belonging to the Ether Family.

: The purpose of a Mantra in this material world can be classified into six groups as per the final objective to be achieved called Shadkarma. Of these only the Shanti ‘Mantra are Satwik. Vasikaran and Stambhanam are Rajasik as the remaining three are definitely Tamasik ‘Only when these are done for the National interest or the ‘welfare/ protection of the world can they be classified as 'Rajasik/Satwik respectively. Details of these rites are given in table 4.9. These are: - ० Suanmi (Pacification) meant for the destruction of diseases, general well being and Emancipation from the cycle of re-birth. > VasyaMm or VasikaraN (Captivation) meant for cap- tivating another in the fofm of bondage or physical attraction efc. e StamBHANAM {(Immobilisation) meant for mentally or physically obstructing a person or group. ० Vipvesana (Dissension) meant for creating differ- ences between couples or close friends or allies. * UccHataNA (Aversion) meant for making a person hate another person or place. 9 Marana (Eradication) meant for causing the death of a person (or enemy). --- ## Page 131 Mantrashastra = - ः 125 Table 4.9 Details of the rites etc. of the Shadkarma. STHAMBAN | VIDVESAN | UCCHATAN | MARAN estha Dungy Mixed Griema

diseases, general well being and Emancipation from the cycle of re-birth. > VasyaMm or VasikaraN (Captivation) meant for cap- tivating another in the fofm of bondage or physical attraction efc. e StamBHANAM {(Immobilisation) meant for mentally or physically obstructing a person or group.

ences between couples or close friends or allies. * UccHataNA (Aversion) meant for making a person hate another person or place. 9 Marana (Eradication) meant for causing the death of a person (or enemy). --- ## Page 131 Mantrashastra = - ः 125 Table 4.9 Details of the rites etc. of the Shadkarma. STHAMBAN | VIDVESAN | UCCHATAN | MARAN estha Dungy Mixed Griema

Astami (8), Navami (9), Navami (9) or Trayodasi (13) ARA (DAY) Wednesday or | Monday or Thumsday Thursday vas al [Gada ~ | Musala ~~ | Vaj

upper part of upper part of botll nostrils hoth nostrils Domestic Fire | Domestic Vata wood fire outside \ya 1५५४ [1778१ | | Patra Tiger skin Other details about the foods, etc should be learnt from the standard Mantra texts, * Mantramahodadhih 25.7 & 8: ऋतुषटक वसन्ताधमहोरात्रं भवेत्क मात्‌ | एषैकस्यक्रतोर्मानं घटिकादशकं RAY । , This is not the normal Ritu or astrological season on the basis of the transit of the Sun. These are the daily temperature fluctuations and are to be based on the six seasons covering the full day of 24 hours. Thus each season ha ,! , sntluence for 4 hours or 10 Ghati. Thus, these season periods start from Va .nta coinciding with Sunrise, Allernatively, the effects can be taken from # AM (oanciding with the start of the Vasant Ritu. Accordingly the timing of the seasonal effects in a day are Vasant (6AM-10 AM), Sisira {10AM-2M), --- ## Page 132 126 Vedic Remedies in Astrology Grisma (2 PM-6 PM), Varsha (6PM-10 PM), Sarada (10PM-2 AM) and Hemanta (2AM-6 AM). ॐ Since the time for the most Satwik Shanti Mantra is 2 AM to 6 AM, this is the best time to worship for a person aspiring for a peaceful life, general well- being, eradication of diseases or Moksha. = Vinyasa: It is the method of adding ones name to the mantra 50 as to be accepted by the Deity of the Mantra. If the deity does not accept the Sadhak, then how can the Mantra fructify? Hence, this Mantra with the name added to it is recited 108 times for acceplance by the Mantra Deity. हैं Granthana: A syllable of the mantra is followed by a syllable of the name. This process is continued till the last syllable of the Mantra. If necessary, the syllables of the name are to be repeated. For example, if “Sanjay” (3 Syllables Sam, Ja & Ya)is to do the Granthana of the Mantra ^ Hare Rama Krishna” (6 Syllables Ha, Re, Ra, Ma, Kri, Sna) then the Granthana Mantra becomes “Ha- Sam-Re-Ja-Ra-Ya-Ma-Sam-Kri-Ja-Sna-Ya”. # Vidarbha: Two syllables of the Mantra is followed by one syllable of the Name. This process is continued till the last syllable of the Mantra is ex- hausted. 1 necessary, the syllables of the name are to be repeated. The final result is the Vidarbha Mantra. . ४ Samputa: The whole Mantra is followed by the name and then the Mantra is repeated in the reverse order of syllables. For example Samputa of the “Hamsa” Mantra is desired by a person named “Sanjay”, then the Samputa Mantra is “Hamsa-Sanjay-Soham”. 4 Rodhana: The mantra is repeated thrice, in the beginning, middle and end of the name. In case the name has odd number of syllables, more are to be used _ in the initial half. For example, if the Ajapa mantra/“Hamsa Mantra” is to be used by “Sanjay”, then the Rodhana mantra is “Hamsa-Sanja-Hamsa-Ya- ' Hamsa”, " 4 Yoga: The Name is prefixed to the Mantra. For example, if the “Hamsa Mantra” is to be used by “Sanjay”, then the Yoga mantra is “Sanjay-Hamsa”. # Pallava: The Name is suffixed to the Mantra. For example, if the “Hamsa Mantra” is to be used by “Sanjay”, then the Pallava mantra is “Hamsa- Sanjay”. ह * Mudra refers to the posture of the hands including the palm and fingers. Refer Standard texts on Tantra like “ Tantrabhidhana”. The names of the Mudra given in the lable are as per the Nabhasa Yoga in Jyotish. . % Mantramahodadhih 25.29: Saanta® vaSyao maRgal hMsal stmBanaaid Yau saUkrl .. 7 Mrigi Mudra is formed by bending & touching the middle and ring fingers (third & fourth counted from the thumb) with the thumb as the index and little finger (second and fifth counted from the thumb) stretches out. # Hamsi Mudra is formed by bending & touching all the fingers except the little finger with the thumb as the little finger (fifth counted from the thumb) stretches out. # Sukari Mudra is formed by contracting the palm and narrowing it as the fingers stretch out. 50 Vama refers to the Akshara or letters used in the Mandala (Yantra). For this , purpose only, the Sixteen Swara (Vowels) and Sa & Tha are taken as the ` Akshara of the Moon. The remaining are as per the Kulaa-Kula Chakra. भ Views of other authorities --- ## Page 133 Mantrashastra हि 127 5 Bhutodaya: There is a fine Jyotish tool for determining the rising of the five elements instead of relying on the breath, which requires a lot of training under a Guru. A day is divided into two Parts called “Ahoratra” ie. Day and Night of 12 hours each. Each such half is divided into 4 Yama of 3 hours each and each Yama is further divided into two Yamardha (Half-Yama literally) of 90 minutes each. The first Yamardha is Aaroha (rising) as the second is Avaroha (decreasing). Each Yamardha 90 minutes has 15 parts of 6 Minutes (or 15 Vighati) each. These are the five Tatwa having the following number of Parts: Prithvi (1), Jala (2), Agni (3), Vayu (4) & Akash (5). For example, let us determine the Tatwa for Tuesday. Since Mass rules the fiery element, the first Tatwa at 6 AM (or Sunrise) is Agni and this has 3 Parts i.e for 18 minutes, Next is Vayu having 4 Parts for 24 minutes and so on. This is Aaroha or . ascending cycle. The next cycle starts at 7.30 AM (approx) and the first three parts are again ruled by Agni for 18 minutes i.e. 730 AM to 748 AM. The next is seen in the reverse since this is an Avaroha or descending cycle: This makes the Water element rise for 2 parts (12 minutes) from 7.48 AM to 8.00 AM. In this manner, the element rising at the given time can be ascertained. 5 Normally auspicious rituals fire should be kindled with the wood of trees having milky sap while in inauspicious rites the wood of Vibhitaka, Dhattura, - Lemon elc are used -% These are the different parts of the flame. The initlal part next 10 the wood is transparent and colorless. This is Suprabha. The orange flame next to it is called Rakta. The yellow flame is called Hiranya and the deep reddish flame above the yellow 15 called Atiraktika. The bluish flame is called Gagana. The heat or invisible flame just above the visible flame is called Krsna. 5 Kaajal: Black sooth from domestic smoke % Visastaka: Eight types of poisonous substances added to the ink. Refer stan- dard texts for details. --- ## Page 134 ॐ गुरवे नम CHAPTER V COMPENDIUM OF MANTRA a) GURU"

Every parampara has its own Guru mantra and any mantra that is communicated verbally becomes a Guru mantra for the person to whom it was communicated. However, here we shall list some of the mantra for worshipping Guru. A person who worships the five deities Ganesha, Surya, Vishnu, Shakti and Shiva (ideally in that order) everyday shall have a smooth and happy life. However, all texts are unanimous in their advise of worshipping the Guru immediately after waking up and before stepping out of the bed. This procedure of daily spiritual disciplene is at Appendix-1.

४.4 nN Om This is the Naisargika Taraka Mantra and is also _ called the Tara Beeja. It is the mantra prescribed for all worshippers of Guru. The Guru Granth Sahib advocates the repetition of this single syllable mantra in its greatest truth “Ek-Omkar” i.e. “single-Om- syllable” is to be recited. This is also advised in the Dakshinamurti stotra etc. 1 This is different from the Gord Beejakshara “Greem” for Jupiter or Guru. --- ## Page 135 2) b) Compendium of Mantra ` 129 GURU SHADAKSHARI ॐ गुरवे नम

| ५ d) Re)

Krishna is regarded as the Jagadguru (teacher of the Universal truth in the form of the mantra OM ` , . ` TATSAT), as Heis the teacher of the Bhagavat Gita PANCHAKSHARI 3 कृष्ण गुरू

Comments: for those persons, who have not been able to find their Guru, recite this mantra and Krishna will surely take you to your spiritual ` teacher. TRAYODASAKSHARI हीं श्रीं क्लीं कृष्णाय जगन्नथाय नमः । Hrim Shrim Kleem Krishnaya Jagannathaya Swaha JacaDGURU MANTRA (ANUSTHUP CHHAND) ॐ वघुदेवसुतं देवं कंसचाणूरमर्दनम्‌ | ` देवकीपरमानन्दं कृष्णं वन्दे जगदगुखम्‌ | Om Vasudevasutam Devam Kansachanurmardhanam. Devakiparamanandam Krishnam Vande Jagatgurum YoGESHWARA MANTRA (BADRINATHA VESHA- ANuUsSTHUP CHHAND) ॐ कृष्णाय यादवेन्द्राय ज्ञानमुद्राय योगिने । नाथाय ख्विमिणीशाय नमो वेदान्तवेदिने | |

- Nathaya Rukminishaya Namo Vedantavedine. ATMA-SAMARPAN MANTRA Recited after the Japa for submission-of the self at the feet of the Lord ` ॐ नमोऽस्तु ते महायोगिन्‌ प्रपननमनुशाधि माम्‌। | यथा नच्वएणाम्भोजे रतिः स्यादनपायिनी | | --- ## Page 136 130 9 5)

Vedic Remedies in Astrology

Mam

HAYAGREEVA MANTRA (LEARNING THE VEDAS) ॐ ऋग्यजुःसामरूपाय वेदाहरणकर्मणे | । प्रणवोद्गीतवपुषे महाश्वशिरसे नम । | Om Rig-Yajuh Samarupaya Vedaharanakarmane Pranavodgitavapushe Mahashvashirase Namah

i) Dhyana ॐ नमः प्रणवार्थाय शुद्धज्ञानैकमूर्तये । निर्मलाव प्रशान्ताय दक्षिणामूर्तये नम । । ` निधये सर्वविद्यानां भिषजे भवरोगिणाम्‌ ।

चिद्घनाय महेशाय वटमूलनिवासिने | सच्चिदानन्दरूपाय दक्षिणामूर्तये नमह | | Om namah Pranavarthaya Suddhaigyaneikamurtaye Nirmalaya Prashantaya Dakshinamurtaye Namah Nidhaye Sarvavidyanaam Bhishaje Bhavaroginaam Gurave Sarvalokanaam Dakshinamoortaye Namah Chidghanaya Maheshaya Vatamulanivashine Sacchidanandaroopaya Dakshinamoortaye Namah Sharana Mantra उं ही करों गुरूदेवमिशं दक्षीणमुर्तये नम | - Am Hrim Kroum Gurudevamisham Dakshinamurtaye Namah iii) Navakshari ॐ दक्षीणामूर्तये नमः | Om Dakshinamurtaye Namah DATTATREYA MANTRA Muniraj Datta was the son of Maharshi Atri* and Anusuya (hence the name Datta-atreya or Datta ग One of the seven Maharishi’s and a co-author of the Rig-veda, Nadi's etc. --- ## Page 137 Compendium of Manira 131 the son of Atri*). They lived in Saurashtra (Modern Gujarat) and their Kuladevata is Sri Somanath. The fact that he was a Muni shows that his Ista Devata was Vishnu. His most important works on Tantricism and the establishment of the Datta- Parampara show his devotion to the Kula Devata (Family deity-Shiva). Thus, the worship of Shiva & Vishnu/Krishna was encouraged in the Vedic times. In the form, which is advocated for worship, he has six arms with two each from Brahma, Vishnu & Shiva and is a composite mixture of all three divinities symbolizing A-U-M (OM in its transcendental form). 1) Sharana Mantra : (@) Prayer . ॐकारतल्वरूपाय दिव्यज्ञानासने नम . नमोऽतीत महाधाम्न एेन्दद्धया ओजसे नमः | 11 नष्टमत्सरगम्याय गम्याचारालवर्तनि | ` मोचितामेध्यकृतये ड्रीबीजश्राणितश्रीये । 1 ‰ मोहादिविभमान्ताय बहुकायधराय च | अक्तदुर्ग भवच्छेतरे क्लीबीजवरजापिने | 13 Ombkaratatwarupaya Divyagyanatmane namah Namoatita Mahadhamne Aindriddhya Ojase namah Nastamatsaragamyaya Gamyacharatmavartamane , i Mochitamedhyakritaye Hrim-BeejaShranitashriye : Mohadivibhramantaya BahukayaDharaya Cha a Bhakta-Durge Bhavacchetre Klim-BeejaVarajapine फ) MalaMantra ॐ हीं कीं ब्रह्महरिहराय दत्तात्रेयाय नमः | Om Hrim Klim Brahma-Hari-Haraya Dattatreyaya Namah. . @ Dasakshari Mantra + ॐ हीं क्ली दलतत्रेयाय नमः | “ Om Hrim Klim Dattatreyaya Namah. # We find mention of other sons of Maharishi Atri as Rishi’s of the Rig Veda like Rishi Rath-atreya (i.e Rath, the son of Atri). --- ## Page 138 1 132:

ii} Other Mantra a) b) c) a e

ॐ दत्त साई

Om Datta-Sai

ॐ दत्त गुरू

Om Datta-Gurum

ॐ ही दत्त गुरूं

Om Hrim Datta-Gurum

ॐ कली दत्त गुरूं

Trayodasakshari (Removing Snake's & related dangers®) ॐ क्लीं आस्तिकं मुनिराजं नमोनमः ।

Om Klim Aastikam Munirajam Namonamah

Replace the name “Sanjay” with the name of the person seeking the shelter of Sri Dattatreya. Draw the following figure and after Pooja and recitation of the mantra (12,000 repetitions), place it inside an ‘amulet to be worn on the neck or right hand. This tan also be inscribed on a gold ring that is worn on the right hand ring finger or a large drawing can be placed in the room on the eastern wall.

ॐ TEE परमात्मने नमः | एत्प्तिस्थितिप्रलयकराय ब्रत्महरिहसय त्रिगुणासने सर्वकीतुकानि दर्शय दर्शय दत्तत्रेयाय नम तन््रसिद्धिं कुरू कुख स्वाहा | Om Parambrahma Paramatmane Namah. Utpattisthi- ¶ Sai Baba of Shirdi is considered the incarnation of Dattatreya for teaching Universal Love as expounded in the Bhagavat Gita. The other incamation is that of Gyaneshwara in which He gave the most brilliant commentary on the Gita at a very young age. $ There are various mantras for removing the effects of Kalasarpa Yoga, Sarpa Yoga and the evil effects of Rahu/Ketu. This is a Guru Mantra and should be used by the initiated. It's results are remarkable. --- ## Page 139 6) Compendium of Mantra , 133 श & य 3 | | { ट x; ४ ] $3 tipralayakaraya BrahmaHariHaraya Trigunatmane Sarvakautukani Darsaya Darsaya Dattatreyaya Namah Tantra-Siddhim Kuru Kuru Swaha. (8) Sarvopari Mantrik Siddli Mantra ॐ परब्रह्म परमासने नमः | उत्पत्तिस्थितिप्रलयकराय ब्रह्महरिडराय त्रिगुणालने सर्वकौतुकानि दर्शव दर्शय दत्तात्रेयाय नमः मच्रसिद्धिं कुरू कुरू स्वाहा | Om Parambrahma Paramatmane Namah. Utpattis- thitipralayakaraya BrahmaHariHaraya Trigunatmane Sarvakautukani Darsaya Darsaya Dattatreyaya Namah Mantra-Siddhim Kuru Kuru Swaha. VEDA Vyasa Maharshi Vyasadeva was the son of Maharshi Parasara. He authored the Mahabharata, Bhagavat Gita and countless other sacred literature of the Hindus. i) Dhyana . व्याष्यामुद्िकयालसत्करतलं सद्योगपीटस्थितं ARAN दधानमपरं हस्तं सुविद्यानिधिम्‌ | विप्व्रातचृतं प्रसनमनसं पाथोरुहाङ्गदुतिं पराशर्यमतीवपुण्यचरितं व्यासं स्मरेत्सिद्धये। | Vyakhyamudrikayalasatkaratalam sadyogapithasthitam --- ## Page 140 134 7) 3)

Vamejanutale dadhanarmaparam hastamsuvidyanidhim, ` Vipravratavrtam prasannamanasam pathoruhangadyufisn Parasanypyamativapunyacaritam vyasam smaretsiddhaye Translation: With the objective of attaining the Siddhi’s [and supernatural powers and abilities], we meditate on the treasure trove of all knowledge, Sri Vyasadeva the most pious and holy. His right palm glows with the light of the Vyakhyana Mudra as his left palm rests on the left knee. He sits in Padmasana on a Yogapitha® surrounded by learned persons (Brahmana). He 15 cheerful and, has the lusture the blue lotus’

(Brana Rishi, Anusthup Chhand, Satyavatiputro devati) चयं व्यासदेवाय नम । Vyam +, (1 1... iii) Vyasa Mantra (Samputita) Vyasa mantra prefixed and suffixed with the Mritunjaya Beeja Mantra bestows incredible results of knowledge, protection etc ॐ जुं स व्यं व्यासदेवाय नमः स जुं ॐ | Om Jum Sah Vyam Vyasadevaya Namah Sah Jum Om.

(@) Trayodasakshari (13 phonemes/syllables) श्री कृष्ण चैतन्याय गौरांगाय नमः | Shrim Krishna Chaitanyaya Gourangaya Namah (b) Chaturdasakshari(14 phonemes or syllables) ॐ श्री कृष्ण चैतन्याय गौरांगाय नम | Om Shrim Krishna Chaitanyaya Gourangaya Namah Remarks: This mantra is recommended only for those Where the previous does not suit as per the mantra tests.

DivINE TEACHERS

The mantra given here are addressed to Brihaspati as the Devaguru (preceptor of the Gods) and not Graha Mantra. The same goes for Sukra the pre- --- ## Page 141 Compendium of Mantra ` 135 ceptor of the demons (or teacher of material know- ledge called Aparaa Vidya) i) Dhyana रलाष्टा पदवस््रराहिममलं दक्षात्किरन्तं करादासीनं विपणौ करनिदधतंरलादिराहौ पम्‌ | पीतालेपनपुष्पवस््रमयिलालडकारसंभूषितं ˆ विद्यासागरपारगं सुरगु वन्दे सुवर्णप्रभम्‌ | | ratrastapadavastrarasimarmalam daksatkirantam karadasinamvipanau karammidadhatarmratnadirasa param, piidepanapuspavastramadulamikarasamblusitan vidyasagaraparagam suragurin oande suoarmaprabham. Translation: O! Ocean of learning, golden hued Teacher of the Gods, (we) sing Thy praise. He sits in the market bedecked with yellow cloths, ornaments, scented pastes and flowers. His left hand rests ona heap of gems, gold and raiments as He distributes these with his right hand. Notes: - (1) A pinch of turmeric and vermilion (Sindoor/ Kumkum) added to the Ghee in the lamp while worshipping Guru brings the blessing of knowledge, wealth and good fortune (2) Wood of Pipal tree offered to the sacrificial fire (yagya) brings the blessing of Maha Vishnu through Guru and torment by enemies; diseases, dissension or strife ends as peace is restored in the locality. (3) The difference between the hands used by Brihaspati (Jupiter-Right hand) and Sukra (Venus- Left hand) in making offerings is used in the Satwik and Tantrik worship or more precisely, in white/ black mystical rituals. For example, the worship of Durga (Divine mother-waxing Moon) is with the right hand while that of Kali (Divine Mother- ______waningMoon) is with the lefthand. ~~ with the left hand. 6 Sad-yogapitha refers to the place of yogasana for performing Sadkarma or satwik praclises and work. This has been previously indicated as Padmasana or the lotus posture, 7 Lustre of blue lotus is the color of the evening sky (light blue hue) as it also refers to Tara Shakti (spouse of Brihaspati) or Nila Saraswati. --- ## Page 142 136

ii) Astakshari Beejamantra बु बृहस्पतये नमः Brim Brihaspataye Namah. iii) Prarihana Mantra (Rig Veda 3.62.5) (Prayer Mantra) Vishwamitra Rishi, Gayatri Chhand, Brihaspati Devata शुचिमरकर्ुहस्प्तिमध्यरेषु नमस्यत | अनाम्योज आ चके | | Suchim-arkair-Brihaspatim-Adhvareshu Namasyata (.) Anamyoja Aa Chake (.) Translation: With excellent, respectable and illuminating thoughts we pray to Brihaspati, for His unmatched knowledge and inviolable (principles of) action. May our desire of these unsurpassable qualities (be fulfilled). iv) Brihaspati Gayatri (Rig Veda 3.62.6) Vishwamitra Rishi, Gayatri Chhand, Brihaspati Devata वृषभं चर्षणीनां विश्वखूपमदाभ्यम्‌ | बृहस्पतिं वण्यम्‌। | Vrishabham charshaninaam Vishwaroopam-adabhyam - (~) Brihaspatim Varenyam (.) Translation:O Great Men! We sing the praise of Brihaspati (the preceptor of the Gods) for the joy of learning and for success in all our good actions, He is the most respectable and the greatest. His wishes are inviolable and we gain in (spiritual) strength by following in His footsteps Note of Caution: (1) Some other mantras are often mistaken as Brihaspati Gayatri. One such mantra reads something like “..vidmahe ..Dhimahi...tanno Guru Prachodayat” and is framed based on the Mantra Mahodadhih of Mahidhara. In that book, Mahidhara also admits that some of the mantra are his own creation (referring to the Gayatri’s) and requests the elders to accept them. When we have the Rig Veda etc. where the Gayatri Mantra’s have | been expounded by the Maharishi’s, [ fail to see the --- ## Page 143 Compendium of Mantra g 137 "need to modify or replace them (2) Others have advised the addition of prefix’s and suffixes like “Om Bhur Bhuva Swa” or “Om Houm Jum Sah” with some of the Rig-Veda Mantra like ' (€ Savitur Gayatri and Mritunjaya Maritra, but this ` 15 only for the initiated. It is advised® that unless otherwise instructed, ONLY the monosyllable “OM” be added to a Gayatri Mantra as per the directions contained in the Ganesha Gayatri’ . By adding other syllables and phonemes, we alter the sound vibration or frequency of the mantra and its effects. ` (3) In the words of Sri Aurobindo Ghose!® “To translate the Veda is to border upon an attempt at the impossible.” In fact every interpretation seems to be apt from the angle and depth of understanding of the translator, yet is grossly deficient in the higher , spiritual thought that is impersonal, universal and full of symbolism. b) SUKRACHARYA (TEACHER OF MATERIALISM) i) Dhyana श्वेताम्भोजनिषण्णमापण तटे श्वेतामबरालेपन . नित्यं भक्तजनाय सम्प्रददतं वासोमणीन्ाटकम्‌ | ` वामेनैवकरेण दक्षिणकरे व्याख्यानमुदराकितं JERE स्मितमुखं वन्देसिताडगप्रभम्‌ | | Svetambhojanisannamapanatate svetambaralepanam Nityam bhuaktajanaya sampradadatam vasomaninhatakam, Vamenaivakarena daksinakare vyakhyanamudrankitam Sukramdaityavararcitam smitanukharm vandesitangoprabham Translation: O! Sukra of feminine body and a 5 ] was initiated into the Gayatri Mantra (Savitur) at a young age. When the chief Puroit (Priest) recited this in my ears, I requested clarification as to why “Om Bhur Bhuva Swa” had been omitted. In his quiet and stern manner, he ` advised me to stick to the Rig-Veda and to recite “OM” mentally while breath- ing in and the rest of the Gayatri Mantra while breathing out. This incident proved to be the beginning of my quest for Para-Vidya (Divine knowledge). * Para 4.2 (4) ® The Secret of the Veda by Sri Aurobindo, Sri Aurobindo Ashram Trust, Pondicherry, India --- ## Page 144 138 9) a) b) थे 9

cheerful face, (we) sing Thy praise. He sits in the market on a white lotus bedecked with white cloths, ornaments, scented pastes and flowers. He distributes gems, gold and raiments with his left hand as His right hand is in the posture of Vyakhana Mudra. He is the preceptor of the sons of Di*i!!. - Mantra ॐ वस्त्र मे देहि शुक्राय स्वाहा |

Om Vastram Me Dehi Sukraya Swaha

These mantra are for higher spiritual realisation. Individual conceptual descriptions are beyond the scope of this book.

सतचिद एकर ब्रह्म Sat Chid Ekam Brahma Translation:

ॐ ऐं हीं श्री क्लीं सो सत््चिद एक ब्रहम Om Eim Hrim Shrim Klim Sauh Sat Chid Ekam Brahma Swa-MANTRA (THE CosMic SELF) ॐ तत्त्वमसि

Translation: “Om”-that is what you are LIGHTING THE INNER LAMP हंस ॐ सोऽहम्‌

Comments: The Dipana mantra for “Om” is “Hamsa Om Soham”. गा Rishi Kashyap had two wives named Diti & Aditi. The children of Diti are called Daitya and are of Demoniacal nature while the sons of Aditi are of Divine nature and are called Deva (Gods). Among the planets the Sun, Moon, Mars & Jupiter are in the Deva group while the other are in the Daitya grou म Ref. Para 4.1.1 (3) (ii) --- ## Page 145 Compendium of Mantra . 139

1) PErSONAL GURU Any teacher is a Guru whereas the teachers of Vedanga can be referred to as Siksha Guru. The teachers of the Veda and spiritual guides are called ' Diksha Guru. The Diksha Guru is to be worshipped ` everyday. Meditate on the figure of the Guru in the *Sahasrara Padma®™" as being of fair complexion and human with two hands and seated in Padmasana™ with the palms in Abhaya and Varada postures. Guru is always to be meditated/ worshipped® with the _ Tara Beeja (Om) and Rama Beeja (Shrim). Thus, the ` Mantra for keeping us close to our chosen Guru should have the Pranava, Rama Beeja followed by “Satguru’”, Name, “Devaya”” and Namah. ` As an example 1 give below the ten mantra that will open the doors of the mind to the Guru ` (Gurudwara). This is based on my research (with ` Sri Manpreet Singh Gambhir} and will require further study of Indian History in the re- establishment of the Guru Parampara initiated by Guru Nanak Dev. 1 Thousand petal lotus in the cranium of the head. # [otus posture where the feet are placed over the thighs. ४ Guru Bhakti Gita by Sri Achyuta Das ¥ ऽव (Truth knowledge/Satwa etc) of Guru as in OM TAT SAT ¥ Devaya refers to Him as the giver (of wealth, light of knowledge etc.}. Diva: Light, to enlighten. --- ## Page 146 Transliteration | Planet | Nanak Dev Sun? ॐ श्रीसतगुरू नानकदेवाय नमः | Om Sri Salguru Nanakdevaya Namah Angad Dev Rahu® ॐ श्रीसतगुरू अंगददेवाय नमः | Om Sri Salguru Angaddevaya Namah Amar Das Satum? ॐ ZEAE अमरदासाय नम | Om Sri Satguru Amardasaya Namah Ram Das Lagna® ॐ HOE रामदासाय नम | Om Sri Satguru Ramdasaya Namah Arjun Dev Jupiter? ॐ श्रीसत्गुरू अर्जनदेवाय नमह | Om Sri Satguru Arjunadevaya Namah Gobind Moon? ॐ श्रीसतगुरू हरगोविन्ददेवाय नम | Om Sri Satguru Hargovinddevaya Namah Har Rai Ketu® ॐ शीसत्‌पुरू हरीयदेवाय नमः | Om Sri Satguru Harraidevaya Namah Har Krishan Mercury?® | ॐ श्रीतगुख हरकृष्णदेवा नमः | Om Sri Satguru Harkrishndevaya Namah Tegh Bahadur Venus? ॐ ओसतगुरू तेजवाहादुर्देवाय नमः | Om Sri Satguru Tejbahadurdevaya Namah Gobind Singh Mars ॐ श्ीसतगुरू गोचिन्ददेवाय नम | . Om Sri Satguru Govinddevaya Namah The strongest planet/Lagna influencing the ninth house from Jupiter brings the Guru. The mantra should be chosen on this basis. Whether one is faithful to Guru is scen from the ninth house from Navamsa Lagna while the ninth from Lagna (Rasi Chart) shows faith & Dharma. The ninth from Karakamsa shows the Atmashakti in the Mantra etc. for invoking the deities. ४ Guru Nanak Dev was the first to re-enlighten this path; Giver of enlightenment (OM) ® Guru Angad Dev used to worship Durga (Destruction of the evil of Rahu) before becoming the Guru. म्‌ Guru Amar Das took the headship of the Guru's at a very old age (Saturn). He worked like a servant for the welfare of all. Service (Saturn. positive) was his motto. Thus, the best way to appease Saturn is to do some service at the Gurdwara or Temple. = Guru Ramdas started the building of the golden temple and also the lineage of the Gurus (He was the son of Guru Amar Das). ® Guru Arjundev compiled the voluininous Guru Granth Sahib. नि # Guru Har Gobind carried two swords (Duality-Moon). One for the protection of Dharma and the other for his followers, Women (Moon) were very loyal to him even under the pain of death. य Guru Har Rai was very disciplined, just like a military officer (Ketu), कै Guru Har Krishan became the head at a very young age {about 6 years-Mercury). The teaching institutions and schools for children {Mercury} are normally named after him. He worked hard to cure (Chikitsaka- Merc+Moon) the plague/ disease spreading in Delhi (Delhi is ruled by Virgo-Mercury). ¥ Guru Tej Bahadur was a Tapaswi (Venus+Satum) and could not see sorrow in others (Venus). ग Guru Gobind Singh was from Patna Sahib, Bihar (Mars) and fought many battles for protecting Dharma. 11141 11/01/1011. --- ## Page 147 5.2 1)

¥ ऽव (Truth knowledge/Satwa etc) of Guru as in OM TAT SAT ¥ Devaya refers to Him as the giver (of wealth, light of knowledge etc.}. Diva: Light, to enlighten. --- ## Page 146 Transliteration | Planet | Nanak Dev Sun? ॐ श्रीसतगुरू नानकदेवाय नमः | Om Sri Salguru Nanakdevaya Namah Angad Dev Rahu® ॐ श्रीसतगुरू अंगददेवाय नमः | Om Sri Salguru Angaddevaya Namah Amar Das Satum? ॐ ZEAE अमरदासाय नम | Om Sri Satguru Amardasaya Namah Ram Das Lagna® ॐ HOE रामदासाय नम | Om Sri Satguru Ramdasaya Namah Arjun Dev Jupiter? ॐ श्रीसत्गुरू अर्जनदेवाय नमह | Om Sri Satguru Arjunadevaya Namah Gobind Moon? ॐ श्रीसतगुरू हरगोविन्ददेवाय नम | Om Sri Satguru Hargovinddevaya Namah Har Rai Ketu® ॐ शीसत्‌पुरू हरीयदेवाय नमः | Om Sri Satguru Harraidevaya Namah Har Krishan Mercury?® | ॐ श्रीतगुख हरकृष्णदेवा नमः | Om Sri Satguru Harkrishndevaya Namah Tegh Bahadur Venus? ॐ ओसतगुरू तेजवाहादुर्देवाय नमः | Om Sri Satguru Tejbahadurdevaya Namah Gobind Singh Mars ॐ श्ीसतगुरू गोचिन्ददेवाय नम | . Om Sri Satguru Govinddevaya Namah The strongest planet/Lagna influencing the ninth house from Jupiter brings the Guru. The mantra should be chosen on this basis. Whether one is faithful to Guru is scen from the ninth house from Navamsa Lagna while the ninth from Lagna (Rasi Chart) shows faith & Dharma. The ninth from Karakamsa shows the Atmashakti in the Mantra etc. for invoking the deities. ४ Guru Nanak Dev was the first to re-enlighten this path; Giver of enlightenment (OM) ® Guru Angad Dev used to worship Durga (Destruction of the evil of Rahu) before becoming the Guru. म्‌ Guru Amar Das took the headship of the Guru's at a very old age (Saturn). He worked like a servant for the welfare of all. Service (Saturn. positive) was his motto. Thus, the best way to appease Saturn is to do some service at the Gurdwara or Temple. = Guru Ramdas started the building of the golden temple and also the lineage of the Gurus (He was the son of Guru Amar Das). ® Guru Arjundev compiled the voluininous Guru Granth Sahib. नि # Guru Har Gobind carried two swords (Duality-Moon). One for the protection of Dharma and the other for his followers, Women (Moon) were very loyal to him even under the pain of death. य Guru Har Rai was very disciplined, just like a military officer (Ketu), कै Guru Har Krishan became the head at a very young age {about 6 years-Mercury). The teaching institutions and schools for children {Mercury} are normally named after him. He worked hard to cure (Chikitsaka- Merc+Moon) the plague/ disease spreading in Delhi (Delhi is ruled by Virgo-Mercury). ¥ Guru Tej Bahadur was a Tapaswi (Venus+Satum) and could not see sorrow in others (Venus). ग Guru Gobind Singh was from Patna Sahib, Bihar (Mars) and fought many battles for protecting Dharma. 11141 11/01/1011. --- ## Page 147 5.2 1)

Compendium of Mantra . ` 141

DHYANA खर्व स्थुलतनु गजेन्द्रवदनं लम्बोदरं सुन्दरं प्रस्यन्दमदगन्धलुबधमधुपव्यालोलगण्डस्थलम्‌ | दन्ताघात विदारितारि रूधिरे सिन्दुर शोभाकरं ` वदे शैलसुतासुतं गणपतिं सिद्धिप्रदं कामदम्‌ | | 7) €) ह |

Kharva Sthulatanum Gajendrabadanam Lambodaram sundaram PrasyandanmadaGandhalubdhamadhupaVyalolaga- ndastalam ` Dantaghata Vidaritari Rudhirai Sindoorashobhakaram Vande SailasutaSutam Ganapatim Siddhipradam Kamadam SAPTAKSHARI MANTRA ॐ गणेशाय नमः । Om Ganesaya Namah Bala Ganeswara Mantra. (Ekadasakshari Mantra) गं ग्लों गणपतये ग्लों गं हीं ।

YANTRA Lord Ganesha, the following Yantra uses the twelve names of Sri Ganesha as given by Narada Muni and is considered most auspicious for education. This has been tried many times by your author and remarkable results have been reported, at times beyond the wildest imagination of the persons using them. This is to be drawn on 2 silver plate/ foil and is to be kept near the study. --- ## Page 148 142 Vedic Remedies in Astrology

ॐ गजाननाय | ॐ वकतुण्डाय | ॐ एकदन्ताय | 3 नमः कृष्णपिंगाक्षाय नम ॐ गजपतये | ॐ नम | गजवकाय | ¦ नमः ` ॐ विनायकाय | ॐ लम्बोदराय | नमः hd ॐ भालचन्द्राय | ॐ धूम्रवर्णाय विध्नराजाय नम 2) SIDDHA MANTRA (a) PRARTHANA (PRAYER) अजम्‌ निर्विकल्पं निराकारमेकं | निरानन्दमानन्दमदतपूर्णम्‌ | परं निर्गुणं निर्विकल्पं निरिहम्‌ | परब्रह्मरूपं गणेशंभजेऽहम्‌। | गुणात्तीतमानम्‌ चिदानन्दखपम्‌ | चिदाभासक सर्वगं ज्ञानगम्यम्‌ | मनिध्येयं आकाशखूपं पेशे | परंबह्मखूपं गणेशभजेऽ हम्‌ | | Ajam Nirvikalpam Nirakaramekam; Nirananda- manandamaddaitapurnam. Param Nirgunam Nirvikalpam Niriham; Parambra- hmarupam GaneshamBhajeaham. Gunateetamanam Chidanandarupam; Chidabhasakam Sarvagan Gyanagamyam. Munidhyeyam Aakasharupam Paresham; Parambra- hmarupam GaneshamBhajeaham. --- ## Page 149 Compendium of Mantra ~ ` „ ` 143 . (b) 0५ ` सर्वविध्नहरं देवं शर्वविध्नविवर्जितम्‌ | सर्वसिद्धिपरदातारम्‌ वन्देहं गणनायकं | | Sarvavighnaharam Devam SarvaVighnaVivargitam SarvaSiddhiPradataram Vandeham Gananayakam (c) MANTRA i) Siddha Mantra नमो गणपते तुभ्यं ज्येष्ठज्येष्ठाय ते नमः | Namo Ganapate Tubhyam JyesthaJyesthaya Te Namah ii) Siddhi Beeja Mantra Siddhi Beeja Mantras of Ganesha are capable of accomplishing any task or desire. The activity desired is to be mentioned with the word “Siddhaye” and “Namah” after either of the two Beeja Mantra. The first mantra is for positive karma whereas the second mantra has the “Astra (Weapon)” and should be used sparingly. (a) Mantra-1 ॐ अन्तरिक्षाय स्वाहा। न

Example: If a person wants to become an expert in Mantras, then the Siddhi mantra for this will be as follows ॐ अन्तरिक्षाय स्वाहा मच्रसिद्धये नम

Mantra-2 ॐ ही पूर्वदयां ॐ हीं फट्‌ स्वाहा । 077 Hrim Purvadayam Om Hrim Fhut Swaha. GaNnEsHA GayaTrI (Ric VEDA) गणानां त्वा गणपतिं हवामहे कवि कवीनामुपमश्रवस्तमम्‌। ज्येष्टराजं बरह्मणां ब्रह्मणस्यत आ न श्रमवनूतिभिः सिद सादनम्‌ | Gananaam twa Ganapatim Havamahey Kavim Kavinamupamasravastamam के --- ## Page 150 144 4) 5) 2) b) a)

Jyestharajam Brahmanaam Brahmanaspata Aa Nah Sranavannutibhih Sidda Sadanam Translation: O Ganesha, Lord of all seers, praise be to Thee; Thou art Omniscient and the unmatched wisdom of the wise. Thou art the precursor (OM) of all prayers and the Lord of all souls; we pray for Thy guidance for success in all good actions. Comments: This mantra clearly advises the prefixing of the monosyllable “OM” before all mantra. VIGHNESWARA MANTRA This famous sixteen-syllable mantra of Sri Ganesh was said to have been recited by Radha Rani to alleviate the suffering that followed the admiration of the Chaturthi Moon by Sri Krishna. Even to this day, the Moon is not seen on Chaturthi and people recite this to come out of the suffering of plahets like Ketu or for the removal of all obstacles. DHYANA: ॐ शुक्लाम्बरघरं विष्णुं शशीवर्ण चतुर्भुजम्‌ प्रसनवदनं ध्याये सर्वविध्नोपशान्तये |

‘Chaturbhujam Prasannabadanam Dhyaye Sarvavighnopashantaye. SHODASAKSHARI MANTRA ॐ गं ग्लो गणपतये विध्नविनाशीने स्वाहा |

LaksHM1 GANESHA MANTRA DHYANA दन्ताभयेचक्रदरौदधानं करागरगस्वर्णघरः त्रिनेत्रम्‌ | धूताब्जयालिडिगतमच्धिपत्रया लज्ञीगणेशं कनकाभमीडे | | Dantabhayecakradaraudadhanam karagragasva- rnaghatam trinetram Dhrtibjayalingitamavdhiputrya laksmiganesam ` kanakabhamide --- ## Page 151 Compendium of Mantra ` 145 - . a) Jara MANTRA 6) i) Saptakshari (Seven letter Mantra) श्री गणेशाय नमः |

ii) Eleven letter Mantra ॐ श्री महागणपतये नमः | 01 Shri MahaGanapataye Namah iii) Fourteen letter Mantra ` Light five Diya (lamps) of Ghee and five incense sticks. Thereafter using a rosary of 108 lotus beads, recite the following mantra (21 rosary every day) ॐ गं गणपतये वर वरद गं ॐ . ` Om Gam Ganapataye Vara Varada Gam Om ` iv) Twenty Seven Letter Mantra ॐ श्रीं गं सोम्य गणपतये वर वरद सर्वजनं मे वशमानय स्वाहा | । Om Shrim Gam Saumya Ganapataye Vara Varada Sarvajanam Me Vasamanaya Swaha v) Freedom from Debts. Use a sphatik rosary (crystal beads rosary of 108 a) beads) for counting and 11,000 mantras are to be recited daily for 40 days. Fo of ग॑ रूण हर्तये गं श्रीं ॐ गणपतये नमः । Om Shrim Gam Runa Hartaye Gam Shrim Om Ganapataye Namah.

This mantra has the power of captivating the entire world and leads to considerable popularity. An excellent mantra for top politicians and ind uatrialists as it has the foundation of the Lakshmi-Ganesha Mantra DHYANA शूलचेक्रे . गदाबीजपृरेधनुः शूलचक्र सरोजोत्पले पाशधान्याग्रदन्तान्‌ | . करः संदधानं स्वशुण्डाशरराजमणीकुम्भमडकाधिरूढं स्वपल्या | | --- ## Page 152 146 छ क

सरोज्मनाभूषणानां भरेणोज्ज्वलदस्ततन्व्यासमालिडिगताङगम्‌ | करीन्द्राननं चन्द्रचूड॑ त्रिनेत्रं जगन्मोहनं रक्तकान्ति भमेकम्‌ | | Gadabijapuredhanuh sulacakre sarojofpale pasadhanyagra-dantan, Karaih sandadhanam svasundagrarajanmani kumbhamanka-dhirudham svapatnya Sarojanmanabhusananim bharenojjvaladdhasta- tanvyasama-lingitangam, Karindrananam candracudam frinetram jaganmohanam raktakantim bhajettam

चक्तुण्डैकदमस्टाय क्लीं हीं श्रीं गं गणपत्तये चर वरद्‌ सर्वजनं मे वशमानय स्वाहा | । Vakratundaika Damstraya Kleem Hreem Shrim Gam Ganapataye Vara Varada Sarvajanam Me Vasamanaya Swaha

This is a very powerful mantra for perfect knowledge, protection and victory in war. Haridra refers to the yellow turmeric used for the purpose of this mantra; dry turmeric has to be ground by an unmarried virgin girl. This turmeric has to be used for anointing the body on Sukla Chaturthi® and taking the blessings of the Guru, the person should meditate and recite the mantra. DHyaNa पाशंकुशो मोदकमेकदन्तं कर्दधानं कनकाखनस्थम्‌ | हारिद्रखण्डप्रतिम॑ त्रिनेत्रं पीतांशुकं रत्रिगणेशमीडे | | Pasamkusau modakamekadantam karairdadhanam Kanuakasanastham, Haridrakhandapratimam trinetram pitamsukam Ratriganesamide DHyanA BEEJAKSHARA MANTRA ग्लो --- ## Page 153 8) 9) a) b) a) by Compendium of Mantra , 147 Glaum

ॐ हुं गं ग्लों हरिद्र गणपतये वर वरद सर्वजनं हृदयं स्थम्भाय स्थम्माय स्वाहा । Om Hum Gam Glaum Haridra Ganapataye Vara Varada Sarvajanam Hridayam Sthambhaya Sthambhaya Swaha

Dhyana उद्यदिनेश्वरख्चिं निजहस्तपे पाशांकुशाभयवरान्दधतं गजास्यम्‌ | रक्ताबरं सकलदुःखटरं गणेशं ध्यायेप्रसन्नमखिलाभरणाभिरामम्‌ | | udyaddines vararucim nijahastapadmaih dpasamkusa- bhayavaran-adhatam gajasyam, raktambaram sakaladuhkhaharam ganesam dhya- yetprasannama Khilalabharanabhiramam MANTRA वकतुण्डाव हुं |

SHAKTI GANEsA MANTRA DHyAaNA विषाणांकुशा वज्ञसूत्रं च पाशं दधानं कीैरमोदकं पुष्करेण | स्वपल्यायुतं हेमभूषभरादढयं गणेशं समुघटिनेशाभमीडे | | Visanamkusa vaksasutram ca pasam dadhanam karairmodakam puskarena, Svapatnyayutam hemabhusabharadhyam ganesam samudyaddine-sabhamide

» EWE

Om Hreem Greem Hreem

ॐ ही गं द्री माहागणपतेये नमः स्वाहा ।

Swaha # Fourth day of the bright fortnight. --- ## Page 154 148 10.

Vedic Remedies in Astrology

DHyaNA: सिन्दूर वर्ण संकाशं योगपट्ट समन्वितं लम्बोदरं महाकायं मुखं करिकरोपमं | अणिमादि Ug अष्टवाहु त्रिलोचनम्‌ विजया विधूतं लिंग मोक्षकामाय पूजयेत्‌ | । । Sindoora Varna Samkasam Yogapatta Samanvitam . Lambodaram Mahakayam Mukham Karikaropamam b) ॐअं 5 38 नमः स्वाहा | { ॐ मं महिमायै नमः स्वाहा Om Mam Mahimayai Namah Swaha ! ॐ इ इशितय नमः स्वाहा । i Om Im Ishitayai Namah Swaha jE i ॐ वं यशिताधै नमः स्वाहा । 1 Om Vam Vasitayai Namah Swaha ॐ प्रं प्राण्ये नमः स्वाहा । - Animadi Gunayuktam Astabahum Trilochanam

SippH1 Pooja Thereafter worship the eight siddhi’s with the fol- lowing mantras, which are symbolized by his eight hands

i Om Am Animayai Namah Swaha

| ॐ कं कामावसितायि नमः स्वाहा | | Om Kam Kamavasitayal Namah Swaha ¡गं गरिमायि नम स्याहा। Om Gam Garimayai Namah Swaha | ns ^ c)

Thereafter the Mouse representing the vehicle of ob- stacles (due to fall in Dharma) is worshipped with the mantra: ॐ मं मुषिकाये गणाधिपवाहनाय धर्मराजाय स्वाहा |

` Dharmarajaya Swaha. 9 Japa MANTRA Thereafter place a 108 bead Hakki. Rosary on the --- ## Page 155 v) «Compendium of Mantra | 149 neck of Ucchista Ganapati and using a Sphatika (crystal) Rosary for counting, the Ucchita Ganapati mantra is recited. Gives Siddhi and great powers. It is vital that the mantra’s given below should be properly checked and the most suitable one be prescribed. Navarna Mantra (Nine syllable Mantra) हस्ति पिसाची लिखे स्वाहा | Hasti Pisachi Likhe Swaha vi) Dasakshari (Ten syllable Mantra -1) ॐ हस्ति पिसाची लिखे स्वाहा | Om Hasti Pisachi Likhe Swaha vii) Dasakshari (Ten syllable Mantra-2) 11. गं हस्ति पिसाची लिखे स्वाहा | Gam Hasti Pisachi Likhe Swaha ix) Dwadasakshari (Twelve syllable Mantra) ॐ हीं गं हस्ति पिसाची लिखे स्वाहा | Om Hrim Gam Hasti Pisachi Likhe Swaha

ॐ नमः उच्चीष्ट गणेशाय हस्ति पिसाची लिखे स्वाहा | Om Namah Ucchista Ganesaya Hasti Pisachi Likhe Swaha. UccHisSTA GANAPATI BALI MANTRA ` The other rituals are the same as given at (6) above except for the Dhyana and the Mantra. DHYANA पच्नाडगान्यस्य कुर्वीत ध्यायेत्तं शशिशेखरम्‌ | Ag रक्ततनुत्रिनत्रं पाशांकुशौ मोदकपात्रदन्तौ | कर्दधानंसरसीरूहस्थमुन्मत्तमृच्छिष्टगणेशमीडे | । Pancanganyaya kurvita dhyayettam sasisekharam, Caturbhujam raktatanumtrinetram pasamkusau modakapatra-dantau, --- ## Page 156 150 5.3. b) 1) 1b) - Vedic Remedies in Astrology Karairdadhanamsarasiruhasthamunmattamucchista ganesamide

गं हं FAI ग्लौ उच्चीष्ठ गणेशाय माहायक्षायं Jette | Gam Ham Klaum Glaum Ucchista Ganesaya Mahayakshyayam Balih . SAVITUR

This is advised for career growth, job etc and for the destruction of poverty. In the Aditya Hridaya Sri Krishna teaches that the “Sun God-Aditya” shculd be worshipped everyday in the morning with the Beejakshara. Surya is akin to Shiva in this worship and in form has three eyes, four arms etc., which are a deviation from the normal. BEEJAKSHARA ir Ghrini DHyAaNA ॐ शोणाम्भोखूहसस्थितं त्रिनयनं वेदत्रयीविगरहं दानाम्भोजयुगाभयानिदधतं हस्तैः प्रवालप्रभम्‌ | केयुराइगदहारक कणधरं कर्णोल्लसक्कुण्डलं ल्ोकोत्पत्तिविनापालनकरं सूर्य्य गुणाव्ि भजे । | sonambhoruhasamsthitam trinayanam vedatrayivigraham danaribhojayugabhayanidadhatam hastailt pravalaprabham, keyurangadaharakam kanadharam kar nollasatkundalam lokotpattivinasapalanakaram suryyam gunabdiim bhaje Meditation: O! Surya, Creator, Sustainer and Destroyer of the worlds, we meditate on Thee. Thou art three-eyed® with the lustre of the red coral and are seated on the pink-lotus throne. The three Vedas (Rig, Yajur & Sama Veda) are Thy body. Thy hindhands* hold the lotus while Thy forehands are % The third-eye is the eye of Wisdom. As such, the Sun God has two eyes, and this being a Jupiterian form, the third eye of Wisdom has been added. भ This is a Jupiterian form of the Sun God with four ams. As such, the Sun God has two hands having two lotuses. --- ## Page 157 ‘Compendium of Mantra 151 in the postures called Abhaya (Fearlessness) and Dana (benevolence) Mudra. Armlets, bracelets, necklace and bangles adorn Thy body and ear-rings - shine in Thy ears. ८) Surva-ADITYA MANTRA i) Dasakshari Mantra (a) For all Businessmen & Professions ॐ हीं quire सूर्य आदित्य श्रीं | Om Hrim Ghrinih Surya Aaditya Shrim. (¢ For Bralmmins & Priests ॐ हीं घृणी सूर्य आदित्य ॐ | Om Hrim Ghrinih Surya Aaditya Om it) Astakshari Mantra (Daily Prayer)* : This is the general mantra for worshipping the Sun God everyday. lf remedial measures are being given or if the worship is to be for the specific Sun sign, then the name of the Sun God “Surya” is to be replaced by His specific name for the Sun sign®.

TABLE 5-II:ADITYA MANTRA

All Signs-Standard | 3 gos सूर्य जादित्य/ | Om Ghrinih SuryaAadityn. ‘manira Aries Om Ghrinih AryamAaditya. Taurus Om Ghrinth Mitraaditya. Gemini Om Ghrinih VarunAaditya. Cancer Om Ghrinih IndrAaditya. Leo Om Ghrinih VivaswanAaditya. Virgo | Pusha Om Ghrinth PushAaditya Libra | 9 got gerald! | Om Ghrinih ParjanAaditya Scorpio EEE Ed Om Ghrinih AnshumanAaditya. Sagitt Om Ghrinih BhagAaditya. Capri | ॐ शरण त्वष्टादित्य/ | Om (11 TwasthAaditya. Aqua ॐ शरणी विष्णु आदित्य Om Ghrinih VishnuAaditye. Pisces ॐ घृणी धाता आदित्य | | Om Ghrinih DhatAadilya. ॐ The Surya mantra could be preceded by the recitation of the Gayatri Mantra where diksha of the same has been obtained CL ॐ Ref table 2.5 --- ## Page 158 152

.d) SurYA (AS GIVER OF KNOWLEDGE) 2) ॐ श्रीविद्या किलि किलि कटकेष्ट सवर्थ साधनाय स्वाहा |

Swaha

A person offering arghya* daily in the morning to the rising Sun and performing Japa at one Sandhya® (i.e at Sunrise/ Morning Prayers) is blessed with long life and fame. Japa is performed in two Sandhya (i.e.morning & evening) begets wealth, good children, learning and prosperity. If in three Sandhya (including midday) then Rajyoga is attained, while if in all four Sandhya (including Tureeya Gayatri or midnight) then final emancipation from the cycle of re-birth is attained. The reasons for this can be understood by applying astrological principles of Solar transit in the day. At sunrise, the Sun is in the Ascendant/Lagna called Dharma Trikona. Thus, Gayatri Mantra at this time ensures good health, reputation and a long life. Such a person will be principled (Dharma Parayana) and ` with high ideals. At sunset, the Suns in the seventh house (Kama Trikona} and the recitation of the Gayatri Mantra promises a happy life, good spouse and the fruits of marriage (children) besides wealth, luck in business, partnership etc. At midday, the sun is in the tenth house (Artha/Karma Trikona) and ensures fame, recognition, and power. At midnight, the sun is in the fourth house (Moksh Trikona)} and gives inner bliss, contentment, occult knowledge and final emancipation. कह oblations (in the form of water). Sometimes red sandalwood paste, honey etc are also added as per the directions of the Jyotish. 5 Sandhya is the junction in the diurnal cycle. This occurs at Sunrise (called Brahma Sandhya), Noon (called Vishnu or Abhijit Sandhya), Sunset (called Mahesha Sandhya) and midnight (called Kali Sandhya or Tureeya meaning . fourth Gayatri) --- ## Page 159 a) b) «Compendium of Mantra 153 NAMASKAR नमः सवित्रे जगदेकचक्षुषे जगत्‌ प्रसूतिष्थिति नाशहेतवे | ` त्रयीमयाय त्रिगुणासधारिणे विरञ्चिनारायण शंकरामने । | सविता पुरस्तात्‌ सविता पश्चात्तात्‌ सवितोत्तरातात्‌ सविताऽधरातात्‌ | सविता नसुवतु सर्वतातिं सविता नो सरतां दीर्घमायु | |

Namah Savitre Jadadekachakshyushe

` Trayemayaya Trigunatmadharine VirinchiNarayana Shankaratmane Savita Purastat Savita Paschattat Savitouttaratat Savitadharattat Savita Nah Suvatu Sarvatatim Savita No Rastam Dirghamayuh

This prayer is addressed to Divine Mother in the form of Gayatri (alias Savitri) who is in the form of the Chhanda (metre of the stanza). It can be recited before any of the Gayatri mantra’s. It is a well known fact that the primary seat of the Divine Mother isin the Yogic Chakra (Wheel) in the throat. We pray to Her to make the rendering/ recitation of the stanza perfect . ॐ आयाहि वरदे देवि जप्ये मे सन्निधो भव | गायन्तं त्रायते समाद्‌ गायत्री त्वं तत स्मृता | | Om Aayahi Varade Devi Japye Me sannidhou Bhava | Gayantam Trayate Jasmad Gayatri Twam Tatah Smrita Translation: O! Divine Mother Gayatri, granter of boons, I beg Thy presence during my mantra recitation (prayers). Those who sing Thy praise (i.e. recite the mantrain Gayatri metre) are sheltered (protected/saved) by Thee and hence, Thy name is Gayatri.

GAYATRI PRANAYAMA

तत्सचिंतुर्वरेण्यं भर्गो देवस्य धीमहि । धियो यो नः प्रचोदयात्‌ । । भूर्भुवः स्वः ॐ | [Inhale] Om Bhur-Bhuva-5wa (.) --- ## Page 160 ` 154 Vedic Remedies in Astrology [Hold Breath] Tat Savitur Varenyam BhargoDevasya Dhimahi(.) Dhiyo Yo Nah Prachodayai(.) [Exhale] Bhur-Bhuva-Swa Om (.) Comments: Pranayama is the method of Yogic breathing that must be learnt from an able teacher. The mantra mentioned above is for the first step/ beginner and is mentally recited while inhaling, holding the breath and exhaling. This should be repeated ten times before starting the chanting as it stabilizes the mind and makes it very focused. There are other modifications for ad vanced practitioners, which include the names of the seven Loka* and are not being mentioned here. त) PrasipDHA Gayatri MANTRA (Ric Vepa 3.62.10) (Vishwamitra Rishi Gayatri Chhand). This is the Dharma Mantra of Satya Sanatana (popularly called Hinduism). “7 तत्सचितुवरिण्यं भर्गो देचस्य धीमहि । धियो यो नः प्रचोदयात्‌ | | (Om) Tat Savitur Varenyam BhargoDevasya Dhimahi(.) Dhiyo Yo Nah Prachodayal(.) Translation: Of Savitur (Creator & Lord of all) we praise® Thee as the cause of the brilliant sunshine” (that burns our sins) and the Omnipresent giver (of life, sustenance and purity). ` % छाप, Bhuva, Swa, Maha, Jana, Tapah and Satya are the seven Loka (realms of existence). ¥ “Om” is not in the original Mantra as given by Maharishi Vishwamitra in the Rig Veda and has been added on the basis of the Ganesha Gayatri. क Varenyam means to sing and praise ॐ Bhargo refers to the “Tejas” or fire of the Sun, its brilliance and shine and its Divine power to eradicate the root of all sins thereby delivering us from evil for the sake of emancipation from the cycle of re-birth. Since it is always present and constantly doing this Holy duty, it is the Omnipresent aspect of God (Vishnu). # Deva can mean both light/ illuminator as derived from Diva or the giver as used in Daata or Devata. Thus in a sence is also defers to the indwelling spirit. ४ ly ५ --- ## Page 161 Compendium of Mantra 155

form) for imbibing the wealth of perfect knowledge.

our intellect, purity, growth (both material and spiritual) and perfection success in all good actions. e) SAMARPAN After the chanting of the mantra is completed (i.e. 108, 1008 or more repetitions have been done as promised in the Sambkalpa) the prayers are offered for acceptance at the Holy feet of Savitur . Thereafter the closing prayer is recited: ॐ उत्तर शिखर जाता भूम्यां पर्वतवासिनी | ब्रह्मणा समनुज्ञाता गच्छ देवि जयेच्छया | |

Om Uttara Shikhare Jata Bhumyam Parvatavasini

f) BLESSINGS OF THE GAYATRI MANTRA A person can get everything he can possibly desire from the regular practise of the Gayatri Mantra. The single greatest blessing is of being truthful® and leading a healthy meaningful life*. g). OTHER SAVITUR GAYATRI (RiG VEDA 5.82.1-9) i) Health & Good appetite ॐ तत्सवितुर्ृीमहे वयं देवस्य भोजनम्‌ | श्रेष्ठ सर्वधातमं तुरं भगस्य धीमहि । । 8 Dhimahi relers Wo the act of meditating (with this mantra). The object of meditation is the Divine light of (kx {referred to carlier as “Bhargodevasya”) and refers to His power of Hluminating our minds with perfect knowledge. This is the second aspect of Gudhead as bring Omniscient or the All-Knowing (Brahma). This is the highest meditation and is the crux of the teachings of Aurobindo. (Ref: तं Aurobindo’s works = “Savitur” and “The Secret of the Veda”, Sri Aurobindo Ashram, Pondicherry. 4 Dhi means intelligence, mind, intellect both conscious and in the higher planes of consciousness or subconsciousness, However, the broad meaning of “hi” has been given by Harihara in the opening prayer of hiv monumental «lassie “Prasna Marga” [Translation Le , हि मध्याटव्याधिपं दुग॑ चियो। ध्यायामि साध्यह बुदे: शध्यै pre निधये | | Harihara prays to Vishnu for “Dhi” in the four forms of Buddhi {(intelligence/enlight- ernment), Suddhi (Purity), Vriddhi (prosperity and growth) and Siddhi (Success in all good actions or perfection). © The single most vital attribute of Godhead is Truth, which is indestructible, sternal and ever victorious. This cuts across all religions and sects. By praying with the Gayatri mantra, we take our first step in spiritual progress by becoming truthful as indicated in the following mantra आ विश्वदेवं सत्यति given नृणीपहे । सत्यसवं सवितारम्‌। | ‰ दि satpatim suktairadhya vrinimahe. Satyasavam Savitaram. (Rig eda 5.82.9 * अनागसो अदितये देवस्य सवितुः सरवे | विर्वा वामानि धीमही | । Anagaso aditaye devasya Savituh save, Vishtog vamani dhimahi. (Rig Veda 5.82.6) --- ## Page 162 156 ` Vedic Remedies in Astrology Tat Saviturvrinimahe Vayam devasya Bhojanam Srestham sarvadhatamam turam Bhagasya Dhimahi. (Rig veda 5.82.1) ii) Wealth & Prosperity ॐ अस्य हि स्वयशस्तरं सवितु कच्चन प्रियम । न मिनन्ति aoe । | Asya hi swayastaram Savituh kanchana priyam. Na minanti swarajyam. (Rig veda 5.82.2) iii) Good fortune & luck ॐ स हि रलानि ary सुवाति सविता भगः | तं भागं चित्रमीमहे | । Sa hi ratnani dashushe suvati Savita bhagah. Tam bhagam chitramimahe. (Rig veda 3.82.3) ` ए} Ending bad dreams & progeny ` ॐ अद्या नो देव सवितः प्रजवत्सावी४ सौभगम्‌ | परा दुष्वप्नयं सुव । | Adhya no deva Savitah prajavatsavih soubhagam. Para duswapnayam suva. (Rig veda 5.82.4) v) Eradication of all evils & sins ॐ विश्चानि देव सवितर्दुरितानि परासुव । यद्‌ भदरं तन आसुव | | Om Vishvani Deva Saviturduritani Parasuva. Yad Bhadram Tanna AaSuva. (Rig veda 5.82.5) 3) AGNI-THE HoLy FIRE OF ENLIGHTENMENT i) Navarna Deepa-Mantra® ॐ हूं रं चैतन्याय नमः | * Also see FAQ 1.0 at Appendix-5. This mantra is popular in another form. It is as follows: ॐ हूं चैतन्याय नमः | Om Hrum Chaitanyayai Namah However, the above mantra has eight syllables whereas it is called the “Navarna Mantra” (Nine-syllabled Mantra) as per the following Stanza from Mantra Mahodadhih. रेा्धशेन्दुषयुक्तं गगनं वहिन am तन्यायहदयतोयं नवाणोग्निधाण्ने | | | Refardheshendusanyuktam Gaganam Vahnichai Tatah | Tanyayahridayamtoyam Navarnoagnidhanne We can either join Gagana (112) and Ardhesendu (um) with Valni (Re) and get the single syllable “Hrum” or we can join Gagana (Ha) with Ardhasendu (um) to get “Hum” and keep Vali (Ra) separate. Since the other syllables put together are seven in number, to get a nine syllabled mantra we have to have two Beejakshara. The second argument is that since the mantra is addressed to the Holy Fire for enlightenment, the Agni (Fire) Beejakshara (called vahni- “Ram” should feature independently. --- ## Page 163 se ii) Compendium of Mantra 157

Remarks: This mantra is used for lighting the lamp (both external for worship and the third eye for spirituality). It removes tamas and lights the lamp of knowledge.

26 syllable*; Brighu rishi; Gayatri Chhanda. वैश्वानर जातचेदा इहावह लोहिताक्ष सर्वकर्मणी साधय स्वाहा | Vaishvanara Jataveda ihavaha Lohitaksha Ssarvakarmani Sadhya Svaha iti) Agni Stambhana Mantra 5.4. a) b) This mantra is used to put out the fires, fever and any form of fear from fire hazards , ॐ § अग्निरूपाय द्वी ॐ नम

Om Hrim Agniroopaya Hrim Om Namah

NAVAGRAHA (NINE PLANETS)

Surya THE Sun Gob

गरहणामादिरादित्यो लोकरक्षणकारकः | विषमस्थानसम्भूतां पीडां दहतु मे रविः । | Grahananadiradityao .Lokarakshanakarakah Vishamasthanasambhutam Peedam Dahatu Me Ravi VYASADEVA'S VEDIC MANTRAY जपा कुसुम सड़कशं काठ्यपेयं महाद्युतिम्‌ | तमोऽरिं सर्वपापष्नं प्रणतोऽस्मि दिवाकरम्‌ । । Japakusum Samkasam Kashyapeyam Mahadhyutim Tamoarim Sarvapapaghnam Pranatosmi Divakaram MANTRA i) Dhyan जपापुष्पोपमांगदयते द्विभुजपह्याभयहस्त सिंदूरवर्णाग्बरमाल्यानु लेपन ५ Most of the Mantra in Gayatri metre are of 26 syllables. Thus, by prefixing “Om” they become 27 syllable which is the number of constellations/ Nakshatra, । ¥ This has been taught by Sri Veda Vyasa in the Navagraha Stotra # The Mantra’s given for the Sun God under Para 5.3 are superior to these Graha Mantra and are recommended for daily practise. --- ## Page 164 158 Vedic Remedies in Astrology ज्वलन्माणिक्यखंचितसर्वागाभरण भास्कर तेजो निधे न्रिलोकप्रकाशक त्रिदेवतामयमूर्ते नमस्ते | । . Japapushpopamamgadhyute Dwibhujapadmabhaya- €; {0514 Sindooravarnambaramalyanu lepanam Jwalanmanikyakhanchitasarvangaabharanam Bhaskaram Tejo nidhe Trilokaprakashaka Tridevatamayamoorte Namaste ii) Surya Graha mantra ऊँ हां हीं हीं सः सूर्याय नमः | Om Hram Hrim Hroum Sah Suryaya Namah iii} Surya Beeja Mantra (Vedic) ॐ git सूर्याय नमः | Om Ghrini Suryaya Namah त) Surva GavaTri (Ric Vepa 1.35.2) Angiras Rishi, Tristup Chhand, Surya Devata आ कृष्णेन रजसा वर्तमानो निवेशयन्नमृतं मर्त्यं च । हिरण्ययेन सविता रथेना देवो याति भुचनानि पश्यन्‌ । | Agkrishnena Rajasa Vartamano niveshayannamritam martyan cha Hiranyayena Savita Rathena Devo yati bhuvanani pasyan Comments: [Krishnena: having the power to attract like all insects/ creatures are attracted to light; Rajasa- Refers to the Sapta Loka; Amritam:nectar of immortality coming from the light of know- ledge]

“Om” they become 27 syllable which is the number of constellations/ Nakshatra, । ¥ This has been taught by Sri Veda Vyasa in the Navagraha Stotra # The Mantra’s given for the Sun God under Para 5.3 are superior to these Graha Mantra and are recommended for daily practise. --- ## Page 164 158 Vedic Remedies in Astrology ज्वलन्माणिक्यखंचितसर्वागाभरण भास्कर तेजो निधे न्रिलोकप्रकाशक त्रिदेवतामयमूर्ते नमस्ते | । . Japapushpopamamgadhyute Dwibhujapadmabhaya- €; {0514 Sindooravarnambaramalyanu lepanam Jwalanmanikyakhanchitasarvangaabharanam Bhaskaram Tejo nidhe Trilokaprakashaka Tridevatamayamoorte Namaste ii) Surya Graha mantra ऊँ हां हीं हीं सः सूर्याय नमः | Om Hram Hrim Hroum Sah Suryaya Namah iii} Surya Beeja Mantra (Vedic) ॐ git सूर्याय नमः | Om Ghrini Suryaya Namah त) Surva GavaTri (Ric Vepa 1.35.2) Angiras Rishi, Tristup Chhand, Surya Devata आ कृष्णेन रजसा वर्तमानो निवेशयन्नमृतं मर्त्यं च । हिरण्ययेन सविता रथेना देवो याति भुचनानि पश्यन्‌ । | Agkrishnena Rajasa Vartamano niveshayannamritam martyan cha Hiranyayena Savita Rathena Devo yati bhuvanani pasyan Comments: [Krishnena: having the power to attract like all insects/ creatures are attracted to light; Rajasa- Refers to the Sapta Loka; Amritam:nectar of immortality coming from the light of know- ledge]

The basic Surya Yantra consists of an eight-petal lotus surrounding the circular disc of the Sun. It is drawn on a copper plate and is worshipped with the following mantra®. + Mantra are from the Aditya Hridaya Stotra taught by Sri Krishna 10 Arjuna before the Mahabharat War. --- ## Page 165

hy Compendium of Mantra 159

Om Suryaya Namah (E)

Om Ravaye Namah (SE)

Om Bhagawate Namah (SW) Om Varunaya Namah (W)

Om Mitraya Namah (NW) `

Om Aadityaya Namah (N)

Om Vishnave Namah (NE)

2) (841401२4 THE Moon Gop a) b)

ॐ रोहिणीशः सुधामूर्तिः सुधागात्रो सुधाशनः | विषमस्थानसम्भूतां पीडां दहतु मे विधु । | Om Rohinishah Sudhamoortih Sudhagatro Sudhashanah Vishamsthanasambhu tam Peedam Dahatu Me Vidhuh VYASADEVA’s VEDIC MANTRA दधि शङ्ख तुषाराभं क्षीरोदार्णव सम्भवम्‌ | नमामि शशिनं सोम शम्भोर्ुकुटभूषण्म्‌ | | : Dadhi Sankha Tusharabham kshirodarnava Sambhavam Nanmami Sasinam Somam Sambhourmukutabhushanam --- ## Page 166 160

MANTRA i) Dhyan ॐ श्वेतः श्वेताम्बरधरो श्वेतमाल्यविभूषणः | गदापागिर्िबाहुश्र स्मर्तव्यो वरद शशी । |

` Gadapanirddwibahushra smartavyo varadah Shashi. d)

ऊँ श्रां of A सः चद्दराय नम | Om Shram Shrim Shroum Sah Chandraya Namah Chandra Beeja Mantra ॐ सौ सोमाय नमः |

Om Soum ‘Soumaya namah

Figure 5-5: Chandrayantra

semicircular disc of the Moon describe the Chandra Yantra. The two holy names of Rama & Krishna are worshipped inside the lotuses by offering white -sandalwood paste.

(Indra Rishi, Soma Devata) इमं देवाऽ अस्रपल्‌ सुवध्वम्महते क्षत्राय | महते ज्यैष्ठयाय महते जानराज्वायेन्दरस्येद्धियाय | | इमममुष्य पुत्रममुष्ये पत्रमस्य विश्च एष वोमी राजा | सोमोऽस्माकं ब्राह्मणानां राजा | | --- ## Page 167 3) a) b) Compendium of Mantra 161 Imam Deva Asapatnam suvadhvammahate kshatraya Mahate jyeshthaya mahate janaraajyayendrasyen- ndriyaya Imammamusya putrammusyayi putramasyai visha Aasha vonii Raja _ Somoasmakam Brahmananam Raja

MancGAL The Gop oF MARs

ॐ भूमिपुत्रो महातेजा जगतोभयकृत्सदा | वृष्टिकृद वृष्टिहर्ता च पीडां दहतु मे कुजः । | Om Bhumiputro mahatejo jagatobhayakritsada Vristikrid vristiharta cha peedam dahatu me kujah

धरणीगर्भसम्भूतं विद्यु्ान्तिसमप्रभम्‌ | कुमार शक्तिहस्तं तं मगल प्रणमाम्यहम्‌ । | Dharanigarbhasambhutam Vidyutkantisamaprabham Kumaram Shaktihastam Tam Mangalam pranamamyaham MANTRA i) Dhyana . . ॐ र्तमाल्याबरधर्‌? शक्तिशूलगदाधरः | १ चर्तर्भूनो मेषगणो वरदः श्रीधरासुतः । | ‘Om Raktamalyambaradharah Shaktishoolagadadharah Chaturbhujo Meshagano varadah Sridharasutah ii) Mangal Graha Mantra ॐकांकींकौ सः भौमाय नमः |

iii) Mangal Beeja mantra

` ॐ HET नमः |

(५१८५7 (Ric VEDA 8.44) Virupaksha Rishi, Gayatri Chchand, Agni Devata अ्ि्मूदा दिवः कक्तिः परथिव्याऽअयम्‌अपां रेतां सि जिन्वति | --- ## Page 168 162

Agnirmurdda divah kakutpatih prithviyaayamapam refam si jinvati DEBT DESTROYING MANGALA MANTRA. [Virupa Rishi, Dharatmaja Devata] i) Dhyana जपाभं शिवस्वेदजंहस्तपदर्गदाशूलशक्तिर्वरंधारयन्तम्‌। अवन्तीसमुतयं सुमेषासन्स्थं धरानन्दनं रक्तवस्त्रं समीडे | | Japabham Sivasvedajamhastapadmairgadasul- _asaktirvaram dharayantam, Avantisamuttham sumesasanastham dharanandanam raktavastram samide. Translation: pay obeisance to (Mars) the Son of the Earth Mother born out of the sweat of Siva® and having the lustre of the Hibiscus flower (Blood red). He lords over Avantika and holds a lotus, club, trident, and spear in his four hands. He wears red garments and rides the mountain goat. ii) Mantra ॐ हं हंसः वं खा | * Om Ham Hamsah Kham Khah. iii) Purification Rite & Mantra _ Using black wood charcoal three parellel lines are drawn on the floor and reciting the following ‘mantra, these lines are wiped off with the left foot in a gesture of wiping out the sins. ॐ दुश्छदौर्भाग्यनष्लाय पुत्रसन्तान हेतवे | ` कृतेखाघ्रयं वामपद्ेनेतदपमार्ज्म्यहम्‌ | | ऋणदुखविनाशाय मनोभीष्टार्थसिदधये। मार्जयाम्षसितारेखस्तिसोजन्त्रयोद्भवाः | | Om Dukhadourbhagya Nashaya Putra Santana Hetave Kritarekhatrayam Vamapadenailat Pramajmaryaham.

ॐ Here the reference is to Kartikeya the elder son of Shiva and Parvati {the Earth Mother). Parasara identifies Him as the deity of Mars, --- ## Page 169 | Compendium of Mantra 163 Marjayamya Sitarekhastisro Janma Trayodbhave. BHAUNA VRATA (FOR OBTAINING A SON/CHILDREN). Many women suffer from delayed childbirth. The remedy is in Bhauma Vrata (Fasting , on Tuesday) such a Vrata if started in the month of Margasira (approx December) is considered auspicious.

Write the 21 mantra inside the 21 triangles of the Yantra or mark 21 vermillion dots inside the triangles "while reciting each of the mantra. The numbers ` given inside the triangles show the order of offering the vermillion (Sindoor). Nyasa The person should wake up early at Brahma muhurta and seating on red rug worship Mars with 21 names (Nyasa) by touching the specific body part while reciting the mantra. ` 1. OmMangalaya Namah (Feet) 2. Om Bhumiputraya Namah (knees) 3. OmRinahartaya Namah (Thigh) --- ## Page 170 164 719 छा के 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21.

Om Dhanapradaya Namah (Waist) Om Sthirasanaya Namah (Genitals) Om Mahakaya Namah (Belly) Om Sarvakaama Virodhakaya Namah (Left Hand) ः Om Lohitaya Namah (Right Hand)

Om Samagana Kripakaraya Namah (Mouth) Om Dhar-atmajaya Namah (Nose)

Om Kujaya Namah (Eyes)

Om Bhutidayakaya Namah (Middle of eye brows)

Om Angarakaya Namah (Pigtail in the crown of the head)

Om Sarvarogapraharine Namah (Both hands) Om Sristi Kartray Namah (Head to foot)

Om Vristikartray Namah (Foot to Head)

gans) ii) Kalash (Water Vessel) , Thereafter fill a Copper Vessel with water and place some red sandal, rice, flower (red color) etc. in it. "Offer this by placing it in front of the Lamp with the following mantra: ॐ भूमिपुत्र महातेजः स्वेदोद्भव पिनाकिनः | सुतार्थिनीप्रपनात्वां गृहाणार्ध्यं नमोस्तुते | | Om Bhumiputra Mahatejah Swedodbhava Pinakinah Sutarthani prapannatwam Grihanaarghyam Namostute. iii) Yantra Pooja Thereafter a copper plate Mangala Yantra (21 triangles) is worshipped with the following mantra [If this is not available, a red coral be placed on a - red color drawing of the Yantra on paper] --- ## Page 171 Compendium of Mantra 165 ऊँ रक्तप्रवाल संकाशं जपाकुसुम सन्निभं | ` WEIGH महाबाहो गृहाणार्ध्यं नमोस्तुते। | Om Rakta- Pravala Samkasam Japkusum Sannibham Mahisutam Mahabahu Grihanaarghyam Namostute. Thereafter reciting the aforementioned 21 mantras, 21 circumbulations of Mangala be done. iv) Purification Rite & Mantra Thereafter sitting in Padmasana or Sukhasana on the red rug say the prayer to Sri Mangala as given at e (iii) above along with the drawing of lines etc. v) Pushpanjali Then, in order to achieve the fulfillment and perfect completion of her worship, that pure lady, taking flowers in her Anjali”! and meditating upon the lotus feet of Mangala, pray to him in the following manner: धरणीगर्भसम्भूतं विद्युत्तेजश्समप्रभम्‌ | कुमार शक्तिहस्तं च मड़गलें प्रणमाम्यहम्‌ | | FORA नमस्तुभ्यं दुश्खदरिद्रय नाशिने | नभसि द्योतमानाय सर्वकल्याणकारिणि | | देवदानवगन्धर्वयक्षराक्षसपन्नगा | सुखं यान्ति यतस्तस्मे नमो धरणिसुनवे। | योवकगतिमापन्नो नृणां दुखं प्रयच्छति | { ` पूनितःसुखसोभाग्यं तस्मै क्षमासूनवे नमः । | प्रसादं करू मे नाथमङ्गलप्रदमडगल | मेषवाहनरूद्रामन्पत्रादेहि धनं यशः | | dharanigarbhasambhutam vidyuttejahsamaprabham, kumaram saktihastam ca mangalam pranamamyaham. rnahartre namastubhyam duhkhadaridryanasine, nabhasi dyotamanaya sarvakalyanakarine. devadanavagandharvayaksaraksasapannagah, sukham yanti yatastasmai namo dharanisunave. थे Anjali is the upper portion of the dress, which is flowing over the shoulder. Alternately, take some red flowers in both hands. . । --- ## Page 172 - 166 4)

yovakragatirnapanno nrnam duhkham prayacchati, pujitahsukhasaubhagyam tasmai ksmasunave namah. prasadam kuru me nathamangalapradamangala, mesavahanarudratmanputrandehi dhanam yash. Translation: O! Mangala (Mars) son of the Earth Mother, I pray to you. You have the nature of lightning, are youthful and bear a spear. O Lord, . the destroyer of debt and poverty, shining in the sky, and bestower of auspiciousness, [ pay my ‘obeisance. | pray to that son of Earth Mother, with whose kindness all mortal and divine beings live in , happiness. I pray to that to that son of Earth Mother, a) : who causes pain when retrograde, while He bestows happiness and good fortune when worshipped. As the bestower of auspiciousness and Lord of good omens, bestow your kindness on us. O! son of Rudra come hither riding your Aries (male mountain goat) and bestow sons, wealth and fame on your worshipper. This fasting on Tuesdays and prayer ` to Sri Mangala is to be performed for one year. Simultaneously, a Brahmin/ Priest be asked to recite the Mangala Gayatri mantra (as given at para d above) 108 times during the Pooja. upDHA THE GoD oF MERCURY

PRARTHANA (PRAYER)

सूर्यप्रियकरो विदान्‌ पीडां दहतु मे बुधः | | Om Utpatarupi Jagatam Chandraputro Mahadhyuti Suryapiyankaro vidwan Peeda Dahatu Me Buddhah, VyasaDEVA's VEDIC MANTRA प्रियडगुकलिकाश्यामं रूपेणाप्रतिमं बुधम्‌ | सैीम्यं सौम्यगुणोपेतं तं बुधे प्रणमाम्यहम्‌ | । PriyanguKalikashyamam Rupenaapratimam Buddham Soumyam Soumyagunoupetam Tam Buddham Pranamamyaham --- ## Page 173 > d)

MANTRA i) Dhyana ॐ पीतांमाल्यांबरधरः सर्पाकारसमदुतिः | खड्गचकगदापाणि सिंहस्थो वरदो बुधः । | ii) Buddha Graha Mantra ॐ oF दी दवौ सः बुदवे नम

iii) Buddha Beeja Mantra ॐ बुं बुद्वे नमः |

Om Boom Buddhave Namah

उदलुध्यस्वाम्न प्रति जागृही त्वमिष्टापूर्ते सं सृजेथामयञ्च | अस्मिन्‌ सधस्थेऽध्युत्तरस्मिन्‌ विश्वेदेवा यजमानश्च सीदत । | . Udbuddhyaswagne prati jagrihi twmestaputem sam . stijethamayancha ` „ b) Asmin sadhastheadhyuttarsmin Vishvedeva yajamanasra sidata

BriaaspaTi THE GoD OF JUPITER

ॐ देवमन्त्री विक्गालाक्षः सदा लोकहिते रतः | अनिकश्िष्यसम्पूर्णः पीडां दहतु मे गुरू | । Om Devamantri Vishalakshah Sada lokahitera ratah Anekasisyasampurnah peedam dahatu Me Guruh

देवानां च ऋषीणां च गुरू काञ्चनसनिभम्‌ | बुद्धिभूतं त्रिलोकेशं तं नमामि बृहस्पतिम्‌ | | Devanaam Cha Rishinaam cha Gurum kanchanasa- nnibham

MANTRA Dhyana ॐ कार्यो देवगुखस्तादरत्ीतवस््रश्रतुर्भृनः | दंडी च वरदः कार्य साक्षसूत्रकमंडलु | । --- ## Page 174 ` 168 6) d) b) >

Om Karyo Devagurustaddatpitavastrasraturbhujah Dandi cha Varadah karya sakshasutrakamandaluh ४) Guru Graha Mantra ॐ गां गीं गौ सः गुरवे नम

vi) Guru Beeja Mantra बुं वृहस्पतये नम

Brim Brihaspataye Namah

वृहस्पतेऽति यदर्यो अर्ह्युमद्विभाति कतुमज्जनेषु | यटहीदयच्छयसऽऋतप्रजात तदस्मासु द्विणंधेहि चित्रम्‌ | | Brihaspateati yadaryo arhaddhyumaddibhati kratumajjaneshu Yaddidayacchavasaritaprajata tadasmasu dravinam- dhehi chitram.

Sukra THE Gop oF VENUS

ॐ दैत्यमन््री गुरूस्तेषां प्राणदश्च महाद्युति । प्रभुस्ताराग्रहाणां च पीडां दहतु मे भृगुः | | Om Daityamanti Gurustesham Pranadascha Mahaddhyutih Prabhustaragrahanaam cha peedam dahatu me Brighuh Vyasadeva's Vedic Mantra हिमकुन्द मृणालां दैत्यानां परमं गुरूम्‌ | सर्वशास््रप्रवक्तारं भार्गवं प्रणमाम्यहम्‌ | | । Himakunda Mrinalabham Daityanaam param Gurum Sarvashastrapravaktaram Bhargavam pranama- myaham MANTRA i) Dhyana ॐ श्वेतः श्वेतताम्बरधर किरीटी च चतुर्भनः | दैत्यगुर प्रशान्तश्च साक्षसूत्रकमण्डलुः | | --- ## Page 175

Om Swetah Swetambaradhara kiriti cha chaturbhuja Daityaguruh prashantasra sakshasutrakamandaluh ... . ii) Sukra Graha Mantra ॐ द्रां दी दरौ स शुक्राय नमः | Oni Dram Drim Draum Sah Shukraya Namah . iii) Sukra Beeja Mantra प) शु शुक्राय नमः । 51100111 Shukraya Namah

अन्नात्‌ परिघुतो रसं ब्रह्मणा व्यपिवस््षतम्पयह्र सोम॑ प्रजा पति ऋतेन सत्यमिन्दियं विपान्‌ शुकमन्धसऽडइन्द्रस्येन््ियमिदम्‌ पयोमृतम्मधु | Annaat parisuto rasam brahmana vyapivatkshiram- payah Somam prajapatih

+. yendriyamidam payomritammadhu ` b ७१५ THE GOD OF SATURN PRARTHANA (PRAYER) 3 सूर्यपुत्रो दीर्घदेहो विशालाक्षः शिवप्रिय ` मन्दचारः प्रसन्नात्मा पीडां दहतु मे शनिः | । Om Suryaputro deerghadeho vishalakshah Shivapriyah Mandacharah prasannatma peedam Dahatu me Shanih VYASADEVA's VEDIC MANTRA नीलाञ्जनसमाभासं रविपुत्रं यमागजम्‌ | छायामार्तण्दसम्भूतं तं नमामि शनैश्चरम्‌ | | Neelanjanasamabhasam Raviputram Yamagrajam Chhayamartandasambhutam tam namami Shanaischaram MANTRA i) Dhyana ॐ इन्द्रनीलदयुतिः शूली वरदो धृतवाहनः | ` नानाबाणासनधरः कर्तव्योऽकर्मुतः सदा | |

PRARTHANA (PRAYER) 3 सूर्यपुत्रो दीर्घदेहो विशालाक्षः शिवप्रिय ` मन्दचारः प्रसन्नात्मा पीडां दहतु मे शनिः | । Om Suryaputro deerghadeho vishalakshah Shivapriyah Mandacharah prasannatma peedam Dahatu me Shanih VYASADEVA's VEDIC MANTRA नीलाञ्जनसमाभासं रविपुत्रं यमागजम्‌ | छायामार्तण्दसम्भूतं तं नमामि शनैश्चरम्‌ | | Neelanjanasamabhasam Raviputram Yamagrajam Chhayamartandasambhutam tam namami Shanaischaram MANTRA i) Dhyana ॐ इन्द्रनीलदयुतिः शूली वरदो धृतवाहनः | ` नानाबाणासनधरः कर्तव्योऽकर्मुतः सदा | |

_ Nanabanasanadharah kartavyoarkasutah sada | --- ## Page 176 170 Vedic Remedies in Astrology ii) Shani Graha Mantra % i प्री परौ सः शनीश्चराय नमह । Om Pram Prim Proum Sah Sanischaraya namah iii) Shani Beeja Mantra शं शनीश्चराय नमः ¦ ` Sam Sanischaraya namah d) Gayatri (Rig Veda 8.18.9) शन्नो देवीरभीष्टय आपो भवतु पीतये । शंयोर भिस्रवन्तु नः । | Shanno Devirabhistaya Aapo bhavantu pitaye. Samyora bhisravantu nah . €) Remedy for Kantaka Sani The following is an extract from Shri Rudram. It should besrecited eleven times everyday morning (after bathing and sitting while facing the east). शं च मे मायाश्च मे प्रियच मे नुकमश्च में कामाश्च मे सौमनसश्च मे भदरं च मे श्रेयश्च में वश्यश्च मे यश्यश्च मे भगश्च मे दविणम्‌ चमे यन्ता चमे धर्ता च मे क्षमाश्च मे धृतिश्चमे विश्वचमे महाश्चमे संविचिश्च मे ज्ञात्रंच मे सुसश्च मे प्रसुसश्च मे सीरं चमे लायाश्च मे ऋतं च मे अमृत च मे यक्षमं च मे नमयच्छ मे जीवतुश्च मे दीर्घयुलं च मे नमित्र च मे अभयं चमे सुगम्‌ मे शयनम्‌ च मे सुषा च मे सुदिनं चमे ॐ Kantaka means ‘Thorn’ and Kantaka Sani occurs when during its transit Satum has special aspect on the tenth house (as reckoned from Lagna, Arudha lagna or Moon} or conjoins it. Since special aspects of Saturn are on the third and tenth house from where it is stationed, the transit of Saturn should be in the 1%, 8* or 10५ house from the Lagna, AL or Natal Moon. Saturn becomes a ` terrible thorn and the journey of life becomes very painful. The fastest and ` most competent will also start limping in their work and the native can lose his job, business may shut down and there will be considerable work related tensions. As Saturn is the thorn, the remedy lies in worshipping Rudra (Mars Deity). Eleven Rudra mantra have also been provided elsewhere in this chap- "ter and depending on the specific Rudramsa occupied, the mantra can be selected for chanting in addition to the remedial prayer at Para 54 {7} (e). --- ## Page 177 न Compendium of Manira 171

- CHA ME NUKAMASHCHA ME 'KAMASHCHA ME SAUMANASASHCHA ME BHADRAM CHA ME SHREYASHCHA ME VASYASHCHA ME YASHASHCHA ME BHAGASHCHA MEDRAVINAM CHA ME YANTA CHA ME DHARTA CHA ME KSHEMASHCHA ME DHRTISHCHA ME VISHVAM CHA ME MAHASHCHA ME ` SAMVICHCHA ME JNATRAM CHA ME SUSHCHA ME PRASUSHCHA ME SIRAM CHA MELAYASHCHAMA RTAM CHA ME-AMRTAM CHA ME YAKSHMAM CHA ME-NAMAYACHCHAME

JIVATUSHCHA ME DIRGHA- YUTVAM CHA ME-

SUGAM CHA ME SHAYANAM CHA ME SUSHA CHA ME SUDINAM CHA ME. Sade-Sati Remedy The transit of Saturn in the 1219 & 2 houses from , the Janma Rasi (Natal Moon sign) is called Sade- Sati or the seven and half year period. Each house is transited by Saturn for about 246 years each. The transit of Saturn in the twelfth house from Moon "sign initiates the Sade-sati when the domestic af- fairs go awry. There maybe turmoil in married life, differences with parents and children, change of residence and many domestic problems. Worship Sri Kali Ma in addition to the Graha Mantra of Sat- urn. The transit of Saturn in the fanma Rasi causes bad company, failure in undertakings, and many per- “sonal problems like loss of reputation, danger from accidents etc. Worship Sri Hanuman in addition to the Beeja Mantra of Saturn. The transit of Saturn in the second house from Moon --- ## Page 178 172 8) a) Ny 9) d) ` , +. Vedic Remedies in Astrology results in many enemies and financial losses, loss of livelihood and danger from Government action. Worship Sri Krishna as well as Saturn.

Ranu: THE DracoN's HEAD

ॐ महाशीर्षो महावक्त्रोमहादष्टो महायशा | अतनुश्चोध्वकेशश्र पीडां दहतु मे तमः | | Om Maghashirsha Mahavaktromahadamstro Mahayasha Atanushchordhavakeshshra peedam dahatu me tamah.

अर्धकायं महाघोरं चन्द्रादित्यविमर्दनम्‌ | सिंहिकासूतं तं राहु प्रणमाम्यहम्‌ | | Ardhakayam mahaghoram Chandradityavimardhanam Simhikasutam tam Rahum pranamamyaham MANTRA 1) Dhyana ॐ करालवदनः खडगचर्मशूली वरप्रदः | नीलसिंहासनस्थश्र राहुरत् प्रशस्यते | | Om Karalabadanah Khadgacharmashooli varapradah Neelasimhasanasthashra Rahuratra prasasyate ii) Rahu Graha Mantra ॐ भां Ff भरी सः राहवे नमः।

iii) Rahu Beeja Mantra शं राहवे नमः |

Ram Rahuve Namah

कया नश्चित्र आ भुवदूती सदावृधः सखा । कया शचिष्टया वृता | | Kaya Naschitra aa bhuvaduti sadavriddhah sakha. Kaya shachistha vritta.

Prarthana (Prayer) ॐ अनेकरूपवर्णश्च शतशोऽथ सहस्रशः : --- ## Page 179 5.5. Compendium of Mantra 173 ` उत्पातरूपी धोरश्चं पीडां दहतु मे शिखी । | Om anckarupavarnascha shatashoatha sahasrashah b) d)

VYASADEVA'S VEDIC MANTRA पलाश पुष्प सङ्काश ताराकागरहमस्तकम्‌ | रौद्र Tero घोरं तं केतु प्रणमाम्यहम्‌ | | Palasha pushpa samkasam tarakagrahamastakam Roudram Roudratmakam Ghoram tam Ketum pranamamyaham. MANTRA i) Dhyana ॐ धूमो द्विबाहुकमिव गाहनो विकृताननः | गृध्रासनगतो निलयं केतुः सर्ववरप्रद | । Om Dhumro dwibahukashraiva gahano vikritananah Gridhasanagato nityam Ketuh sarvavarapradah ii) Ketu Graha Mantra ऊँ त्रां AT A सः केतवे Ts | ` 077 Tram Trim Troum Sah Ketave nanigh iii) Ketu Beeja Mantra कं केतवे नमः |

Gayatri (Ric VEDA 1.6.3) केतं कृण्वन्नकेतवे पेशो मर्या अपेशसे । समुषदभिरजायथाः | , Ketum krinvavoaketave pesho marya Apeshase.

NAKSHATRA (CONSTELLATION) The deities of the birth constellation are regularly ` worshipped. Sometimes, the deities of other constel- lations are also worshipped for specific results. For example, during an eclipse the deity of the constel- lation where the eclipse occurs is worshipped. Two ‘mantras are indicated against each constellation. --- ## Page 180 174

‘The first is a Gayatri/ Mala-mantra and the second is the Beeja Mantra. की i) Aswini (अश्विनी) ॐ अश्विना तेजसा चक्षुः प्राणेन सरस्वती वीर्यम्‌ वाचेन्द्रो बलेन्द्राय दधुरिन्दरियम्‌ | ॐ अदिवनीकुमाराभ्यां नम Transliteration: 1.0m Aswinaa Tejasa Chakshyuh Pranena Saraswati Veeryam Vachendro BalendrayaDadhurindriyam -2. Om Aswinikumarabhyam Namah ii) Bharani (भरणी) ॐ यमाय ला मखाय ल्वा सूर्यस्य ला तपसे देवस्तया सविता मध्या नवतु | पृथिव्या संस्पकास्पाहि अर्चिरसि शोचिरसि तपोसि | ` ॐ यमाय नमह | Transliteration: 1. Om Yamaya Twa Makhaya Twa Suryasya Twa Tapase Devastwa Savita Madhwa Navatu (.} Prithivya Samsprisspahi Archirasi Souchirasi Taposi 2. Om Yamaya Namah -ii) Krittika (कृत्तिका) ॐ अनिनरमूर्धा दिवः ककुक्तिः प्रथिव्या अयम्‌ । अपां रेतसि जिन्वति । ॐ अग्नये नम Transliteration: 1, Om Agnirmurdha Divaha Kakutpatih Prithvya Ayam (~) Apam Retamsi Jinvati. 2. Om Agnaye Namah iv) Rohini (रोहिणी) ॐ ब्ह्मयज्ञानं प्रधमं पुरस्ताद्धिसीमतः सुखूयो येन आवश | सुवुध्या उपमा . अस्यविष्ठाः सतश्र योनिमसतश्च विक | | ॐ ब्रह्मणे नमः । । Transliteration: ` 1. Om Brahmayagyanam Prathamam Purastadwi- simatah Surucho Vena Aavah (.) Subudhnaya Upama i --- ## Page 181 Compendium of Mantra 175 Asyavistha Satasra Yonimastasraviva (.) 2. Om Brahmane Namah v) Mrigasira (मरगय्सरा) ॐ इमं देवा असपलां सुवध्वं महते क्षत्राय महते ज्यैष्टयाय महते , जानराज्यायेन्दस्येन्दियाय । दुमममुष्य पुत्रममुष्य पुत्रमभ्य विष एष वोऽभी राजा सोमोऽस्माकं ब्राह्मणानां राजा | ॐ चन्द्रमसे नम || Transliteration: 1. Om Imam Deva Asapatnam Suvadhwam Mahate Kshetraya Mahate Jyesthyaya Mahate ‘Janarajyayendrasyendriyaya (.) Imamamusya Putramamusyai Putramabhya Visha Easha Voami Raja Somoasmakam Brahmananaam Raja (.) 2. Om Chandramase Namah ~ vi) Ardra (अद्र ॐ नमस्ते रूद्रमन्यव उतोत इषवे नमः । बाहुभ्यामुत ते नम | ॐ ख्द्राय नमः ¦ | Transliteration: Om namaste Rudramanyava Utota Isave Namah () Bahubhyamuta-te Namah (.) ` Om Rudraya namah viii) Punarvasu (पुनर्वसु) : ॐ अदितिद्यौरदितिरन्तरिक्षमदिति्माता स पिता स पुत्रः । विश्वेदेवा अदिति पंचजना अदितिर्जातिमदितिर्जनिल्यम्‌ | ॐ अदितये नमः || Transliteration: 1.0m Aditidhyomaditirantarikshamditirmata Sa Pita Sa Putra (.) Visvedeva Aditihih Panchajana Aditirjatamditirianitwam (.) 2.0m Aditaye Namah viii) Pusya (पुष्य) ॐ बृहस्पते अति यदर्यो अर्हाद -दुमद्विभाति ऋतुमज्जनेषु । यदीदयच्छवस ऋतप्रजातदस्मासु द्रविणं धहि चित्रम्‌ | --- ## Page 182 ` 176

ॐ बुहस्यतये नम । । Transliteration: 1.0m Brihaspati AtiYadaryo Arhadyumaddwibhati Riturajjaneshu (.) Yaddwidayacchavasa Ritaprajata Tadasmasu Dravinam Dhehi Chitram () 2.0m Brihaspataye Namah ix) Aslesha (अङलेषा) ॐ नमोस्तु सर्पेभ्यो ये के च प्रथिवीमनु ये अन्तरिक्षे ये दित्रि तेभ्यः wi नमः ॐ सर्पेभ्यो नमः । । Transliteration | ः 1.0m Namostu Sarpebhyo Ye Ke Cha Prithivimanu Ye Antarikshe Ye Ditri Tebhyah Sarpebhyo Namah () 2.0m Sarpebhyo Namah x) Magha (मघा) ॐ पितृभ्यः स्वधायिभ्यः स्वधा नमः पितामहेभ्यः स्वधायिभ्यः स्वधा नमह | प्रपितामहेभ्यः स्वधायिभ्यः सवधा नप अक्षनपितरोमीमदन्त पितरोऽ तीतृपन्तपितर पितर शुन्धध्यम्‌ | ॐ पितृभ्यो नमः । | "Transliteration: 1.0m Pitribhyah Swadhayibhyah Swadha Namah Mitamahebhyah Swadha Namah (.) Prapi tamahebhyah Swadhayibhyah Swadha Namah Akshannopitaro- mimadananta Pitaroatitripantapitarah Pitarah Sundadhwam (.) 2. Om Pitribhyo Namah xi) Purva Phalguni (पू फाल्गुनी) ॐ भगप्रणेतर्भगसत्य राधो भगे मां धियमृदवाददन्नः भगप्रमोजनगो गोभिरश्यर्भ गप्रनृभिनूर्वतेस्वाम | ं ॐ भगाय नमः | | Transliteration: Om Bhagapranetarbhagasatya Radho Bhage Mam Dhiyamudvadadannah Bhagapranojanago Gobhi- --- ## Page 183 . Compendium of Mantra ` ` 177 । faswairBhagapranribhinrirvatesyam (.)

, xii} Uttara Phalguni (उ फल्गुनी) ॐ देव्यावध्वर्यू आगतं रथेन पूर्यलचा । मध्या यज्ञं समजञ्जाधे तं प्रलया यं ` चेनश्चित्रमु | ॐ अर्यम्णो नम | Transliteration: 1.0m Devyavadhwaryu Aagatam Rathena Suryatwacha (.) Madhwa Yagyam Samanjathe Tam Pratnuaya Yam Venaschitram (.) , 2. Om Aryamane Namah iii) Hasta (हस्त) ॐ विभ्राइबहत्पिबतु सौम्यं मध्वावुर्दधद्यज्ञपताविर्हुतम्‌ वातजूतो यो अभिरक्षतिमना.. प्रजा पुपोष पुरुधा विराजति | ॐ सवित्रे नमः | | Transliteration ` ` 1.01 Vibhradbahatpibatu Soumyam Madvaryu- dadhadhyagyapatavavirhatam Vatajuto Yo Abhiraksha- titmana Prajah Puposha Purudha Virajati (.) 2. Om Savitre Namah xiv) Chitra (चित्रा) ॐ ल्वष्टातुगेयो अदभुन इन्द्राग्नी पुष्टिवर्धना द्विपदाच्छन्दऽटुन्द्रयमक्षागौनविमोदधु | ॐ विक्वकर्मणे नमः । Transliteration: Om twastaturoyo Adbhuta Indragni Pustivardhana Duwipada-chchand Indrayamakshagounavimodadhu. Om Vishwakarmane Namah xv) Swati (स्वाति) : ॐ वायो ये ते सहसिणो रथासस्तेभिरागहि Praga सोम धीतये | ॐ वायवे नम || Transliteration ` Om Vayou Ye Te Sahasrino rathastebhiragahi --- ## Page 184 178 `

nityutwana Soma pitaye. Om Vayuve Namah xvi) Visakha (विराखा) : ॐ इन्द्राग्नी आगत सुतं गीर्भिनमो वरेण्यम्‌ अस्पातं धियेषिता | ॐ इन्द्राग्निभ्यां नमः | Transliteration: 1.0m Indragiti aagatam sutam girbhirnamo varenyam aspatam dhiyeshita 2.0m Indragnibhyam Namah xvii) Anuradha (अनुराधा) : ॐ नमो मित्रस्य ET चक्षसे महादेवाय तदृतं सपर्यत दूरदरो देवजाताय केतवे दिवस्पुत्राय सूर्याय संसत 1 | ॐ मित्राय नम | Transliteration 1.0m namo Mitrasya Varunasya chakshase Mahadevaya tadritam saparyatam duradrimse devajataya ketave divasputraya Suryaya samsata. 2.0m Mitraya Namah. xviii) Jyestha (ज्येष्ठा) : ॐ त्रातारमिन्द्रमवितारमिद्रं हवे हवे सुहवं शूरमिन्द्रम्‌ | हृयामि शकं पुरुहूतमिन्द्रं स्वस्ति नो मघवा wifes | ॐ इन्द्राय नमः | Transliteration: 1.0m trataramindramavitaramindram have have suhavam suramindram. Hayami sakram puruhita- ` वामा swasthi 110 11104140 dhatwindrah. 2.0m Indraya Namah xix) Mula (मूल); ॐ मातेव पुत्रं पृथ्वी पुरीष्य्मग्नि स्वे योनावभारूखा तां विश्व ऋतुभिः पवदानप्रजापतिर्विक्वकर्मा विमुञ्चतु | ॐ निऋतये नमः । Transliteration ` 1.0m Mateva Putram Prithvi purishyamagni swe --- ## Page 185 Compendium of Mantra . 179 yonavabharukha tam vishva ritubhih samvadanapra- japatirvishvakarnia vimunchatu. 2. Om Nirttaye Namah xx) Purvasadha (पूर्वाषाढा] ॐ अबाधमपकिल्विषमपकृल्यामपोरपः अपामार्गलयमस्मदषदु? ष्यप्वं सुव | । ॐ उद्रभ्यो नमः । Transliteration 1.0m Abadhamapakilvisampakrityamaporapah apamargatwanmsmadashaduh Swapyam suva 2. Om Adrabhyo Namah xxi) Uttarasadha (ऊत्तराषाढा ४) ॐ विश्वेदेवाः श्रणुतेमं हवं ये मे अन्तरिक्षय उपद्यविष्ठा ये अग्निजिहा उतवा यजत्रा आसद्यास्मिन्‌ यज्ञ वर्हिषि मादयध्वम्‌ | ॐ विश्वेभ्यो देवेभ्यो नमः. । Transliteration: Om Vishvedevah Srinutemam havam ye me antarikshaya upadhyavistha ye agnijihwa utawa yajatra asadhyasmin yagye varhishe madaysdhwam.

xxii) 579४272 {श्रवण 3) ॐ विष्णो रराटमसि विष्णोः श्नपवेस्थो विष्णोः स्यूरसि विष्णे्धुवोऽसि वैष्णवमसि विष्णवे ल । ॐ चिण्वे नमः । Transliteration: 1. Om Vushnou raratamasi Vishnnouh snapvestho Vishnouh syurasi Vishnourdhuvoasi Vaishnavamasi Vaishnave twam. 2. Om Vishnave Namah xxiii) Dhanista (धनिष्ठा 2) ॐ वसो पवित्रमसि शताधारं वसो पवित्रमसि सहस्रधारम्‌ । देवस्त्वा सविता पुनातु वसो पवित्रेण शतधारणे सुप्या काममधुक्ष | । ॐ वसुभ्यो नमः --- ## Page 186 ` 180

ॐ नमो भगवते वासुदेवाय 1 Transliteration: 1. Om Vasou pavitramasi satadharam Vasouh pavitramasi- sahasradharam. Devastwa Savita punatu Vasouh pavitrena satadharane supwa kamamadhuksha ` 2. Om Vasubhyo namah 3. Om namo Bhagavate Vasudevaya xxiv) Shatabhisa (शतमिषा 3) ॐ वरूनस्योत्तम्भनमसि वरूणस्य स्कम्भसर्जनीस्थो वरूणस्य ऋतऽ सदन्यसि वरूणस्य ऋतसदनमसि चरूणस्य ऋतसदनमासीद्‌ | ` ॐ चखणाय नमः । ` Transliteration 1. Om Varunasyottambhnamasi Varunasya ' skambhasarjanistho Varunasya ritasadanamasi

` 2.0m Varunaya Namah xxv) Poorvabhadrapada (पूर्वामादपद $) ॐ शिवो नामासि स्वधितिस्ते पिता नमस्ते अस्तु मामा Bde । निवर्त याम्यायुषेऽ ननाद्याय प्रजननाय रायस्पोषाय सुप्रजास्त्वाय सुवीर्याय |

Transliteration: ` 1. Om Shivo namasi swadhitiste pita namaste astu mama himsih. Nivartayamyayusheannadhyaya prajannaya rayasposhaya suprajastwaya suviryaya 2.0m Ajaikapade namah . xxvi) Uttarabhadrapada (उत्तराभादपदा 3) ॐ उत नोऽहिर्बध्यः श्रुणोज एकपासूथिवी समुद्र | विश्वेदेवा ऋतावधीनहुवानः स्तुता मत्रा कविशस्ता अवन्तु । : ॐ अहिर्बुध्न्याय नम । | Transliteration: 1.0m utanoAhirbudhanyah srinotwaja ekapatprithivi samudrah. Vishvedeva ritavadhinahuvanah stuta man- --- ## Page 187 Compendium of Mantra 181 tra kavisasta avantu. 2. Om Ahirbudhanyaya Namah xxvii) Revati (ait 3) ॐ पूषनत्चत्रते वयं न रिष्येम कदाचन स्तोतारस्त इहस्मसि | | ॐ quit नमः | Transliteration: 1. Om Pushanatawatrate vayam rishyem kadachana stotarasta chasmasi 2. Om Pushane namah 5.6. RASIMANTRA The Janma Rasi is the sign occupied by the Moon in the birth chart. If this is not available, then the Rasi should be determined from the starting letter of the name. The Rasi Mantra can also be used to remove the evils of any particular sign/ house in a horoscope. Rasi/Moon sign Trasliteration Aries/Mesha ॐ विष्णवे नः | Om Vishnave Namah Taurus/ Vrisab ॐ वासुदेवाय नम | Om Vasudevaya Namah Gemini/ Mithun ॐ कंशवाय नमः | Om Keshavaya Namah Cancer/Karkata ॐ राधाकृष्णाय नमः | Om Radha-Krishnaya Namah Leo/Simha ॐ हरिहिगाय Om Hariharaya बालपुकून्दाय नम | ‘} Balamukundaya Namah Virgo/Kanya ॐ दरी पिताष्वरायं Om Hrim Pitambaraya परमात्मने नमः | Paramatmane Namah Libra/ Tula ॐ श्रीराम दाशरथये नक | | Om Sri Ram Dasrathaye Namah Scorpio/ ॐ नारायणाथ नमः | Om Narayanaya Namah Vrischik* ॐ नराय नमः | Om Naraya Namah Sagittarius/ ऊँ हींश्रींकीं Om Hrim Shrim Krim Dharani Dhanus धरणी धराय नमः | Dharaya Namah Capricomn/ ॐ श्री वत्सलाय नमः | Om Shrim Vatsalaya Namah Makar Aquarius/ ॐ श्री उपेन्द्राय {ता Shrim Upendraya Kumbha* अच्युताय नम | Achyutaya Namah ॐ क्लीं गोविन्द Om Klim Govinda-Gopalaya गोपालाय नमः | "| Namah Pisces/ Meena ॐ की रथांग _ | Om Krim Rathanga-Chakraya चक्राय नमः| Namah * Two mantra have been given for the two lordships of these signs. The First mantra is for the node (Kahu/Ketw) while the second is for the planet (Saturn/ Mars) for the signs Aquarius and Scorpio respectively. --- ## Page 188 182 5.7. 1)

VISHNU Vishnu

i) Dhyana शान्ताकारं भुजगशयनं पद्मनाभं सुरेशं विश्वाधारं गगनसदृशं मेधवर्णम्‌ सुभांगम्‌ | लक्ष्मीकान्तं कमलनयनं योगिर्भध्यान गम्यम्‌ ` वन्दे विष्णु भवभयहरं सर्वलोकैकनाथं | | ग Shantakaram Bhujagasayanam Padmanabham Sureshar | Vishwadharam Gaganasadrusham Meghavarnam Subhangam . Lakshmikantam Kamalanayanam Yogirbhidhyana Gamyam Vande Vishnu Bhava-bhaya-haram Sarva Lokaikanatham. ii) Shadakshari ॐ विष्णवे नमः |

` iii) Saptakshari ॐ हूं विष्णवे नमः ।

iv) Tri-Beejakshara

lettered mantra) by adding the Pranava (Om) at the beginning and “Swa” at the end.

. ह्लीं श्ली कली --- ## Page 189 i" Compendium of Mantra C183

Hleem Sleem Kleem

3 oi af

Hreem Shreem Kreem

i) Dhyana ॐ ध्येयः सदा सवितृमण्डल मध्यवर्ती नारायण सरसिजसन सन्नी . विष्ट | ः : केयुरवान्‌ मकर कुण्डलवान्‌ किरी टीहारी हिरण्मयवपुर्घूत शंखचकः | | Dhyayet Sada Savitrimandala Madhyavarti Narayana Sarasijasana Sannivista.

. Hiranmayavapurdhrita Sankhachakrah. ii) Mantra . ॐ नमो नारायणाय | a

SAaTYA NARAYANA MANTRA. i) Dhyana ध्याये सव्यं गुणतितं गुणत्रयसमन्वीतं लोकनाथं त्रीलोकंशं कोस्तुभावरणं हसिम्‌ पीताम्बरं नीलवर्णम्‌ श्रीवत्सपदभूषीतम्‌ गोविन्दं गोकुलानदम्‌ बहमदरभी पुजीतम्‌। ।

Dhyayet Satyam Gunateetam Gunatrayasamanyetam

Harim

tam

tam. ii) Mantra ॐ तत्‌ सत्‌ . --- ## Page 190 184 . Vedic Remedies in Astrology OM TAT 547 iii) Ista Mantra हरि ॐ तत्‌ सत्‌ Hari** Om Tat 54 उ3 This is the highest mantra for worshipping Krishna/Vishnu and is mentioned in the Bhagavat Gita. Extracts from “Bhagavat Gita As it is” by H.H.Srila Prabhupada Om tat sad iti nirdego brahmagas tri-vidhau smatan brihmadas tena vedi ca yajidg ca vihitid pura SYNONYMS Oa—indication of the Supreme; tat—that; sat—eternal; iti—thus; nirdegav-—indica- tion, brahma&au—oft the Supreme; tri-vidhai—threefold; smatai—is considered, brahmagii—the brihmagas, tena—--with that; vedav—the Vedic literature; ca—also; yajiau—sacrilice;, ca—also; vihital—used; puri—formerly. TRANSLATION From tbe beginning of creation, the three words Om tat sat were used to indicate the Supreme Absolute Truth. These three symbolic representations were used by brihmanas while chanting the hymns of the Vedas and during sacrifices for the satisfaction of the Supreme. PURPORT It has been explained that penance, sacrifice, charity and foods are divided into three categories; the modes of goodness, passion and ignorance. But, whether first class, second class or third class, they are all conditioned, contaminated by the material modes of nature. When they are aimed at the Supreme—Om tat sat, the Supreme Personality of Godhead, the etemal--they become means for spiritual elevation. In the scriptural injunctions, such an objective is indicated. .... Whenever a Vedic hymn or the holy name of the Supreme Lord is uttered, Om is added. This is the indication of Vedic literature. These three words are from Vedic hymns. Om ity etad brahmano nedstham nama (Rg Veda) indicates the first goal. Then tat tvam asi (Chandogya Upanishad 6.8.7) indicates the second goal; and sad eva saumya (Chéndogya Upanisad 6.2.1) indicates the third goal. Combined they become Om tat sat. Formerly when Brahma, the first created living entity, performed sacrifices, he indicated by these three words the Supreme Personality of Godhead. Therefore, the same principle has always been followed by disciplic succession. So this hymn has great significance. Bhagavad-gita recommends, therefore, thal any work done should be done for Om tat sal, or for the Supreme Personality of Godhead. When one performs penance, char- ity and sacrifice with these three words, he is acting in Krsna consciousness. saThe Rig Veda teaches that the holy name “HARI” ends all enmity and peace is restored. This holy name is followed by the name/manitra of “Indra” or your Lord. Thus, there can he many mantra like Hare Guru, Hare Krishna, Hare Rama, Hari Om, Hari Om Tat Sat etc. Sri Achyuta Das also teaches (Guru Bhakti Gita) that in this age of Kali (Strite) the Natural Mantra is “Hare Krishna”. रस्य सस्थे न वृण्वते ह समत्सु शत्रवः | तस्मा इन्द्राय गायत | | Yasya Sansthe Na vrinvate Hari Samatsu Satravah. Tasma Indraya Gayat.(Rig Veda 1.5.4) 35 Extracts from Bhagavat Gita As it is by HH Srila Prabhupada: These three words, Om tat sat, particularly indicates the Absolute Truth, the Supreme Personality of Godhead, The three words om tat sat are uttered in conjunction with the holy name of the Supreme Lord, e.g., om fad vishnu. --- ## Page 191 ‘Compendium of Mantra ’ , 185 d) Vishnu Gayatri (Rig Veda 1.22.20) तद्िष्णोः परमं पद सदा पश्यन्ति सूरयः | दिवीव चक्षुराततम्‌ | | Tad Vishnu Param Padam Sada Pasyanti Surayah (.) - Diveevah Chaksyur-Aatatam (.) e) Dhanada Mantra. The word “Dhana” refers to the wealth in the form of a medium of exchange like currency or grain as in the ancient world as well as the means of sustenance of the body in the form of food. Thus, there can be other interpretations of this word, which results in four types of Hora Charts (D-2 . Charts). The primary function of Vishnu is to sustain this creation by providing food for which His Shakti Lakshmi becomes the goddess of corn. ॐ नमो विष्णवे सुरपतये माहाबलाय स्वाहा | . Om Namo Vishnave Surapataya Mahabalaya Swaha. The second function of Vishnu is to provide dhana in the form of accumulated wealth for which purpose His Shakti Lakshmi becomes the goddess of wealth. ॐ नमो विष्णवे सुरपतये धनाडाय स्वाहा |

दी Das-Avatar Mantra The Das-Avatar refers to the ten forms of Sri Vishnu. These are (1) Sri Matsya (Fish form-Ketu), (2) Sri Kurma (Tortoise form-Saturn) (3) Sri Varaha (Boar ` form-Rahu) (4) Sri Nrisimha (Man-lion form-Mars) (5) Sri Vamana (Priest or Brahmin- Jupiter) (6) Sri ___Parasuram (Warrior Priest-Venus) (7) Sri Buddha® Parasuram (Warrior Priest-Venus) (7) Sri Buddha® % Buddha Avatar is conceived sa the student who teaches by example or reorients the - thought. In the natural order of Creation, the Buddha Avatar is Gautama Buddha as He reoriented the thinking by driving the people away from the misinterpretation of the Veda, which had fallen to the low levels of animal sacrifices. However, there is some apparent confusion in this area as different texts give different Buddha-Avatar. My understanding is that there are many Buddha- Avatar as it shows the ideal disciple who . shows the path by example. Thus if the texts say that Sri Balaram is the Buddha- Avatar, they are correct in that Sri Balaram showed the way of the warrior by introducing the principles of body building and that of the farmer in the principles of agriculture. Bhakta Prahalad the son of Hiranyakashipu, showed the path of unflinch- ing faith against oppression hy his own father and thus, is a Buddha-Avatar, Lakshmana the younger brother of Sti Rama showed complete obedience of the elders and is also . a Buddha-Avatar. In this very manner, every worshipper of Vishnu aims at becoming a Buddha-Avatar or perfect Vaishnava. --- ## Page 192 186 ` "Vedic Remedies in Astrology (Student-Mercury) (8) Sri Rama (Perfect Human form- Sun) (9) Sri Krishna (Transendental Human form-Moon) and (10) Sri Kalkin (Divine protector- Ascendant). The Mala-mantra for the Das-avatar normally is as the Madhusudana Dwadasakshari followed by the names® of the Avatar in the 2109६ order (each name is preceded by “Om” and the Beejakshara of the Ista). Thereafter, add “jaya jaya salagrama nivasine” and the reference to the “Divyaroopd” or divine form. The mantra closes with “Namah Om” and the Beejakshara. Two examples of Das-Avatar mala-Mantra are given below as well as the Dharma Gayatri of Vishnu (Refers to the Vamana Avatar) 1) Narasimha Das-Avatar Mantra Lord Narasimha is the chosen Ista Deva and the Beejakshara is “Kshraum” ॐ नमो भगवते नरसिंहाय ॐ क्षों मत्स्यरूपाय, ॐ क्षौ कूर्मखूपाय, ॐ श्रो वराहरूपाय, ॐ क्षौ नूसिंहरूपाय, ॐ क्षौ वामनरूपाय, ॐ क्षो. ॐ क्षौ. ॐ क्षौ रामय. ॐ क्षो कृष्णय ॐ क्षौ कल्किने जय जय शालग्रामनीवासिने दिव्यसिंहाय स्वयंभूवे पुरूषाय नमः ॐ क्षौ |

Om Kshraum Matsyaroopaya, Om Kshraum Koormaroopaya, Om Kshraum Varaharoopaya, Om Kshraum Nrisimharoopaya, Om Kshraum Vamanaroopaya, Om Kshraum, Om Kshraum, Om Kshraum Ramaya, Om Kshraum Krishnaya, Om Kshraum Kalkine

*7 Here, the names of Parasurama and Buddha- Avatar are specifically omitled due to the Parasurama-Rama continuum (i.e. destruction of Adharma symbolized by Parasurama is followed by the establishment of Dharma symbolized by Rama) and Student-Teacher continuum (i.e. every student sysabolized as Buddha shall become a teacher symbolized by Vamana). However, the Om and Beejakshara are repeated twice for them. --- ## Page 193 Compendium of Mantra 187 Divyasimhaya swayambhuve purushaya Namah Om Kshraum 1) Krishna Das-Avatar Mantra Lord Krishna is the chosen Ista Deva and the Beejakshara is “Kleem” ॐ नमो भगवते वासुदेवाच ॐ क्लीं मत्स्यरूपाय. ॐ क्लीं कूर्मरूपाय, ॐ करत वराहरूपाय. ॐ क्लीं नृसिंहरूपाय ॐ क्लीं वामनरूपाय्‌ ॐ क्ती ॐ क्लीं ॐ FA रमय. ॐ क्ती कृष्णय, ॐ क्लीं कल्किने जय जय शालगामनीवासिने नारायणाय स्वयभूवे पुरूषाय नमः ॐ क्ती | ‘Om Namo Bhagavate Vasudevaya,

- Om Kleem Varaharoopaya, Om Kleem Nrisimha- roopaya, Om Kleem Vamanaroopaya, Om Kleem, Om , Kleem, Om Kleem Ramaya, Om Kleem Krishnaya, Om 2) a)

Jaya Jaya Salagrama nivasine ः Narayanaya swayambhuve purushaya Namah Om Kleem Remarks; Note that the difference between the two Das- Avatar mantra is in the reference to the deity “Narasimha” & “Vasudevaa”, their Beejakshara ` “Kshraum” & “Kleem” and in their “Divyaroopa” (Divine forms) as “Divyasimha” and “Narayana”. iii) Dharma Gayatri (Vamana Avatar Rig Veda. 1.22.18) त्रीणि पदा वि चकमे विष्णुर्गोपा srr | अतो धर्माणि धारयन्‌ | Trini pada Vi-Chakrame VinurGopa Adabhyah (.) Ato Dharmani Dharayan (.) Rama Rama TARAKA MANTRA i) Mantra (1) र रामाय नमः | (Rum Ramaya Namah) % The Taraka Mantra always stari with the Vahni Beejakshara (Holy Fire seed syl- lable} “Rm --- ## Page 194 188

ii) Mantra (2) रं रामभद्राय नमः | (Rum Ramabhadraya Namah) * iii) Vishnu Taraka Mantra b) हरि ॐ Hari Om Beeja Mantra i) Rama Beeja श्री Shrim. 11) BeejaMantra ॐ श्रीरामय नमः |

iii) Beejamantra-1 (Dwadasakshari) राम परमात्माराम निरञ्जन

iv) Beejamantra-2 (Shadakshari) = राम निरञ्जन ं Ram Niranjana v) Beejamantra-3 (Trayodasakshari) ॐ श्री राम जय राम जय जय राम ` Om Sri Ram Jaya Ram Jaya Jaya Ram ©) d) KarMA NEETI MANTRA नमो अनन्ताय | Namo Annantaya

i) Sita-vallabha mantra ॐ नमो भगवते सीताबल्लभाय स्वाहा | Om namo Bhagavate Sitavallabhaya Swaha Remarks: This is a miraculous mantra for marriage problems. ii) Sita-Ram Mantra ॐ श्रीसीतारामचन्द्राभ्यां नमः | --- ## Page 195 . 3) a) b) ९) Compendium of Mantra ~ 169

iii) Sita-Pati Mantra (Anusthup Chhand) रामाय रामभदाय रामचन्द्राय वेधसे रघुनाथाय नाथाय सीताया४ पतये नम | Ramaya Ramabhadraya Ramachandraya Vedhase Raghunathaya Nathaya Sitayah Pataye Namah iv) Rama-Raksha Mantra (Anusthup Chhand) ॐ रामभदं महेष्वास रघुवीर नृपोत्तम | भो दशास्ान्तकास्माक रकं कुर श्रियं चमे | | । Om Ramabhadram maheshvasa Raghuvira Nripo- ttama. Bho Dashasyantakasmakam Raksham Kuru Shriyam Cha Me. NARASIMHA

i) Narsimha Beejakshar (Atri Rishi) क्ष Kshraum. ii) Three letter mantra of Narsimha & a7 &t

iii) Narsimha Shadakshara (6 letter mantra for Sri Narsimha) जय जय श्रीनृसिंह

Jaya Jaya Sri Nrisimha.

i) Satru-Marana Mantra ॐ नं नृसिंहाय शत्रुभुजबल विदीर्णाय नम

Namah NarasiMHA MALA-MANTRA i) Lakshmi - Nrisimha mantra (31 letter ) Padvanabha Rishi --- ## Page 196 190 + Vedic Remedies in Astrology ॐ श्री हीं जयलक्ष्मीप्रियाय नित्यप्रमुदित चेतसे लक्ष्मीश्रिताईदेहाय श्रीं ` हीं नमः। ॥ १1111111. /. (1.1.74 11/11, (11... (1. a) ChetaseLakshmi-Sritarddh-Dehaya Shrim Hrim Namah. 11) Ugraveera Narasimha? Anusthup Chhanda उग्रवीरं महाविष्णुं ज्वलन्त सर्वतोमुखं नृसिंहं भीसणं भटम्‌ Jee नमाम्यहं | (हावटट्टाीः Mahavishnum jwalantam sarvatormukham Nrisimham Bhishanam bhadram mrityurmrita Namamyaham

Miscellaneous Vaishnava mantra

(Ananta Rishi, Pankti Channda & Pakshindra devata) क्षीप ॐ स्वाहा ` ` Kshipa Aum Swaha. , Dhyana: We meditate on the king of Birds of molten ; gold lusture (Golden eagle) adorning ornaments of , the serpents with a quivering serpent in his beak. He instantly removes the poison and has the Abhaya and Narada Mudras (posture of palons) in his two hands as he recites the same Geeta. - Remarks: Five lakh Japa of this mantra in best for any form of de-addiction or removing any kind of poison from the body. “Vishnubhakti paro nityam yo bhajet pakshi- nayakam ~ Satrunsarvanparabhaya Sukhi bhogasamanvita.” ` This mantra destroys enemies, sorrow and misery, removes addictions and gives pure devotion for Sri ` : Vishnu. 1t ensues a long life of 100 years and thereafter a berth in Vaikuntha. ॐ There is another version of this Mantra as given by Sri Shivananda. ॐ उरग वीर महाविष्णुं ज्वलन्तं विश्वतोमुखम्‌ | नृसिं भीषणं भद' sey नमाम्यहम्‌ | --- ## Page 197 5.8. 1) 2) 9) Compendium of Mantra - | 191 KRISHNA

Af Klim.

Krishna Mantra

1) Shastakshari क्लीं कृष्णाय नमः |

ii) Astakshari ॐ क्लीं श्रीकृष्णाय नमः | Om Klim SriKrishnaya Namah iii) Dasakshari . । न ॐ हलीं श्लीं कली श्रीकृष्णाय नम | ` . (ता जल्ला Kleem SriKrishnaya Namah

i) Dhyana कल्पानोकहमूलसस्थितचवोराजोनतां सन्धितं पोष्पवाणमथेक्षुचापकमलेपाशाकुरोविभ्रतम्‌ । घकंसंस्वरगदिकीरूद्धिजार्सश्लिष्टदेहं हरि नानाभूपणरक्तलेपकमुमं पीताम्बरं संस्मरेत्‌ | Kalpunokahamulasamsthitavayorajonnatam _Sasthitam paushpambanamathekshuchapakamale- | pashanikushebibhratam Chakramsamkhagadaikarairudadhijasamslistadeham Harim NanabhushanaRaktalepaKusumam Pitambaram Sam- smaret. Translation: We meditate on Hari (Govinda/ Krishna) adorning yellow garments and seated on Garuda (Bald Golden eagle-king of the birds) under the Kalpavriksha®. He has eight arms® bearing a * All desire fulfilling Holy heavenly tree. The roots of the tree are in heaven and 15 branches in this world. Tt is symbolized by* the Holy Tulsi. न The eight arms symbolize the eight syllables of the Govinda mantra. --- ## Page 198 192 ` Vedic Remedies in Astrology _ floral arrow, sugarcane bow, lotus, noose, goad, discus (Sudarshan Chakra), conch (Sankha) and mace. The resplendent Goddess Lakshmi adorned with various sweet flowers and ornaments embraces him. His forehead is anointed with Red Sandal wood , paste®, ii) Mantra (Eight Syallable) Sammohana Narada Rishi _ कली ऋषीकेशाय नम । Klim Hrishikeshaya Namah. iii) Garuda mantra Thereafter worship Garuda with the under- ‘mentioned mantra and the Govinda Mantra is ‘repeated 12 lakh times (12,00,000). When Jupiter is in debility or weak or if the saints® and pure people . are being harassed by evil one’s, then Hari comes to their rescue in the same way as He liberated Gajendra (the king of elephants from the jaws of Makara {the crocodile). पक्षीराजाय स्वाहा | Pakshi-Rajaya Swaha € Rukmini Vallabha Mantra. (16 syallable) Narada Rish । i) Dhyana चिन्ता्मयुक्तनिजदोपरिरबध्कान्तमालिडिगतं सजलजेन करेणपल्या | सीवण्वित्रयुतहस्तमनेकभूषं पीताम्बरं भजत कृष्णमभीष्टसिद्धयै | | Cintasmayuk tanijadohparirabdhakantamalingitam Sajalajenakarenapatnya Sauvarnavetrayutahastamanekabhusam pitambaram € Red sandalwood paste called Rakia Chandan is offered to Krishna as the protector ‘of Dharma since this is the favorite scent/decoration of the Sun God. © The mantra refers 10 Krishna (Hari) as Rishi-Keshava or the hair (Kesha) adom- ment of the Saints (Rishi). Thus as a part of the Gayalri Manira Siddhi, the saints and Brahmins do not shave/cut their hair during the period of the penance. The drawings and pictures of the Rishi & Maharishi’s always show them as having long beard and "hair tied in a knot above the head. In contrast, we see the pictures of Muni's (dedicated "devotees of Bhakti Marg) as being bald and committed to a life of celibacy. --- ## Page 199 d) €) ` Compendium of Mantra 193 छाप krsnamabhistasiddhyai ii) Mantra ॐ नमः भगवते रूक्मिणीवल्लभाय स्वाहा |

Oni Namah Bhagavate Rukmini-Vallabhaya Swaha.

(Eight Syllable) Brahma Rishi i) Dhyana हरिं पञ्चवर्ष वृजेधाचमानं स्वकषौन्दर्यसम्मोहितं स्वर्गयोषम्‌ | यशोदासुतं स्त्रीगणैर्डष्टकेलिं भजे भूषितं भूषोर्नूपुराधि; । । Harim pancavarsam vrajedhavamanam svasaundarya sammnichitam svargayosam, Yasodasutam striganairdrstakelim bhaje bhusitam husanairnpuradayih Translation: We meditate on Krishna as a child of five years. He, the son of Yashoda, adorns fine jewellery and anklets. He enchants the divine fairies and admiring damsels with his playful pranks in Vraja ii) Mantra क्ती गोवल्लभाय स्वाहा |

Klim Govallabhaya Swaha.

(Narada Rishi; Anustup Chanddah) i) Dhyana विजयेनयुतोरथस्थिकतः प्रसमानीय समुद्रमध्यत£ । प्ददत्तनयान्दिजन्मने स्मरणीयो वमुदेनन्दनः | | Vijayenayutorathasthitahprasamaniya samudramadhyatah, Pradadattanayandvijanmane smaraniyo vasudevanandanah Translation: We meditate on Lord Krishna and Arjuna emerging from the sea in the brilliant chariot of victory. The Lord brings forth and offers an illustrious baby boy (the child of the devotee) ii) Mantra देवकीसुत् गोविन्दं वासुदेवं जगत्पतिम्‌ --- ## Page 200 . 19. ` Vedic Remedies in Astrology देहीमेतनयं कृष्णंल्ामहाम्‌ शरणंगत | . Devakisutam Govindam Vasudevam Jagtpatim Dehim-Tanayam Krishna-twa-maham Saranagatah. Comments: (1) It is best to start this mantra in a - Holy place near the sea (this is mentioned in the meditation), preferably Puri in India as the mantra specifically refers to the Jagannath form with the word “Jagatpatim”. One lakh Japa followed by a proper Pooja as described above gives an illustrious and dutiful son. ` iii) Bandha (Blockage) Removal The horoscope should be checked for “Bandha” or blockage from the Arudha Pada of the 3% & 9५ houses from Lagna and Sun as given in the Jaimini Sutra. If the Bandha is caused from Lagna, then in addition to the above, the Bhauma (Mars) Santana Mantra should be recited. {a) Diva-Mantra This is to be recited with the morning prayers after lighting the lamp. ॐ भोमश्वराय § पूरणश्वराय नमः | Om Bhoumeshwayraya Bum Purneshwaraya Namah (b) Ratri-Mantra This mantra is to berecited in the night before mating. ॐ पूर्णन्दु पूर्णेश्वराय योगाधिक्लप्रकटाये पुत्र प्रदातव्य नमः | Om Purnendu Purneshwaraya Yogadhibalaprakatayai Putra Pradatavyai Namah Name Mantra i) Janaka Shadakshara (Janaka Rishi) ` हरेरामकृष्ण Hare-Ram-Krishna --- ## Page 201 ‘Compendium of Mantra 195 ii) Mahamantra. हो कृष्ण हरे कृष्ण कृष्ण कृष्ण हरे हरे ` हो राम हरे राम राम राम हरे हरे नि Hare Krishna Hare Krishna Krishna Krishna Hare Hare Hare Ram Hare Ram Ram Ram Hare Hare. Remarks: This mantra is for Name Kirtana and is the most effective and purifying mantra in Kaliyuga. This mantra is suitable for one and all and 16 rosary everyday is sure to take you to the feet of Chaitanya Mahaprabhu. 2) Radhe-Krishna Mantra i) Radha-Krishna Mala Mantra® राधे श्याम राधे श्याम श्याम श्याम राधे राधे राधे कृष्ण राधे कृष्ण कृष्ण कृष्ण राधे राधे Radhe Shyam Radhe shyam Shyam Shyam Radhe " Radhe Radhe Krishna Radhe Krishna Krishna Krishna Radhe Radhe ii) Radhika Astakshari ee राधिकाये श्रीयं | : Radhikaye Shreyam Namah iii) Radha-Krishna Mantra (14 Syllable) ॐ क्ली कृष्णाय राधिकाये श्रीयं नमः | Om Kleem Krishnaya Radhikaye Shriyam Namah h) (Dwadasakshari) Madhusudana Mantra® ॐ नमो भगवते वासुदेयाय | ` Om Namo Bhagavate Vasudevaya. Remarks: It is advisable to recite the Mahusudana Stotra before and after chanting this mantra. The ४ This Mantra is also called the Murali Mahima i.c. the power of the Flute of Sri Krishna & There is a modified form of this mantra called the Madana Mantra. भत्र ! ॐ नमो भगवते वासुदेवाय कृष्णाच मंडलवलिमादाय हन हन हूँ फद स्वाहा | Om Namo Bhagavate Vasudevaya krishnaya Megalavalimadaya Hrwa Hana Hum Fhut Swaha --- ## Page 202 196 3) i)

Krishna & There is a modified form of this mantra called the Madana Mantra. भत्र ! ॐ नमो भगवते वासुदेवाय कृष्णाच मंडलवलिमादाय हन हन हूँ फद स्वाहा | Om Namo Bhagavate Vasudevaya krishnaya Megalavalimadaya Hrwa Hana Hum Fhut Swaha --- ## Page 202 196 3) i)

mantra is derived from the first syllable of each of the 12 stanzas of the Madhusudana stotra. It is complete in itself, covers all aspects of life, and finally gives Moksha as described in one of the stanza: “Garbhavasam Mahadukhat Trahimam Madhusudana”. Govinda Mantra-1 (Anusthup Chhand) ॐ कृष्णाय वासुदेवाय हरये परमासने | प्रणतक्लेनाशाय गोविन्दाय नमो नमः | | Om Krishnaya Vasudevaya Haraye Paramatmane. Pranataklenashaya Govindaya Namo Namah Govinda Mantra-2 (Anusthup Chhand) ॐ कृष्णाय वासुदेवाय देवकीनन्दनाय च | नन्दगोपकुमाराय गोविन्दाय नमो नम | । Om Krishnaya Vasudevaya Devakinandanaya Cha. Nandagopakumaraya Govindaya Namo Namah. "KRISHNA ASTADALA PADMA (YANTRA) Pooja ‘There are three ways of worshipping Krishna in the eight-petal lotus. These are in the form of Bala- Gopala (Baby Krishna), Gopala (Youth pastimes in

The Yantra used is the same, but the meditation, mantra and procedure is different a)

Figure 5-7: Sri Krishna Yantra

(Narada Rishi). This mantra also requires the use of the eight-petal lotus for Siddhi/ perfection. 1t bestows wealth, fame and success in all actions. Like uprooting the Arjuna trees and releasing the souls of the cursed Yaksha's, Bala-Gopala (Baby Krishna) removes all obstacles, redeems all our sins and curses. People without jobs or with work related problems find solutions. After the meditation and 4-lakh-mantra recitation, perform the fire sacrifice --- ## Page 203 Compendium of Mantra . 197 with 40,000 mantra. Thereafter, worship the treasures in the eight directions (petals of the Yantra) and the Digpala and their weapons. This Pooja is normally done on Mondays and Wednesdays i) Dhyana कल्पटुमूलसंख्ठपह्यस्थं चिन्तयेदरिम्‌ । क्पद्रोरतिरमणीयपल्येभ्यःप्रोदभूतै्मणिनिकःप्रसिक्तमीशम्‌ | ध्यायेयं कनकनिभारुकेवसानं भुञ्जानं दधिनवनीत्‌ पायसानि | | Kalpadrum?® ulasmrudhapadmastham cintayeddharim Kalpadroratiramaniyapallavebhyah prodbhutairmani Nikaraihprasiktamisam, © Kalpadruma yoga is caused by the placement of the Lagnesh (Lord of ascendant is # quadrant etc the dispositor (say-D1) of the lagnesh should also be strong in a quadrant etc, the navamsa dispositor (say D2) of this dispositor (D1) should also be strong in the Rasi Charl in quadrant /own sign / exaltation. The blessings of the Kalpavriksha come to the person with Kalpadruma yoga. Such person can never be detested *Theae three are like the Lagna {Lagnesh represents the body and the Maya Becja Hrim (हीं), Moon (Dispositor of lagriesh or Lord of Paka Lagna and the Rama Beeja Shrim (वीं) and Sun (Navamsa dispasitor of Paka Lagnesh and the Krishna Beeja Klim (क्ली). If all three are strong, then Kalpadruma yoga results. --- ## Page 204 198 Vedic Remedies in Astrology Dhyayeyam kanakanibhamsukevasanam bhunjanam Dadhinavanitapayasant. ii) Bala-Gopala Mantra क्ती कृष्ण क्लीं

iii) Mantra for the treasures Table 5-3: Treasures Mantra ॐ महापद्माय नम Om Mahapadmaya Namah ॐ पद्माय नम Om Padmaya Namah ॐ शंखाय नमः Om Samkhaya Namah ॐ मकराय रम Om Makaraya Namah ॐ कच्छपाथ नमः | Om Kacchapaya Namah ॐ मुकुन्दाय नमः | OmMukundaya Namah ॐ कुन्दाय नमः Om Kundaya Namah ॐ नीलाय नमः Om Nilaya Namah iv) Mantra of ten Digpala Digpala’s are the Lords of ten directions as well as the Dasamsa.

Table 5-4:Digpala Mantra

Indra (East) ॐ ल इन्द्राय नः! | OmlamIndraya Namah 4०७8) Om Ram Agnaye Namah Yama (South) OmMam YamayaNamah Nairrtafi (South Wesd) Om Ksham Nairrtaye Namah. Varuna (West) Om Vam Varunaya Namah. Vayu (North West) Om Yam VayuveNamah Soma (N) OmSamSomayaNamah. sana (NE) Om Hum Isaniyu Namah, Brahma (Vertical down) Om Am Brahman Namah. Ananta (Vertical Up) Om Hrim AnantayaNarmah. न Amkusha is a tiny pointed spear like abject used for controlling and driving el- ephanis, । --- ## Page 205 Compendium of Mantra 199 v) Mantra of ten Diqpala Weapons Table 5-5: Mantra for Weapons of Digpala Weapon Transliteration Vajra (Thunderbolt) Om Vajraya Namah Shakti (Spear) Om Shaktaya Namah Danda (Staff) Om Dandaya Namah Khadga (Broadsword) Om Khadgaya Namah

Pasa (Noose) Om Pasaya Namah

Amkusha (Spear) Om Ankushaya Namah

Trishula (Trident) ॐ शूलाय नम । | Om Shoolaya Namah - Padma (Lotus) Om Padmaya Namah

b) METHOD-IL: Gopala Yanta (& Mantra) i) Dhyana वृन्दारण्यगकल्पपादपतले सदरलीयेम्बुजे शोणाभे वसुपत्रके स्थितमजं षीताम्बरालंकृतम्‌। „ , जीमूताभमनेकभूषणयुतं गोगोपगोपीवृतं गोविन्दं ¢ . ER मुनियुतं वेणुं रणन्तं स्मरेत्‌ | . Vrindaranyagakalpapadapatale sadratnaPithembuje .. .. Sonabhe vasupatrake sthitamajam pitambaralamkritam Jimutabhamanekabhushanayutam gogopagopivrittam Govindam Smarasundaram muniyutam venum ranamtam smaret. Translation: We meditate on Govinda (Krishna) playing the flute®. He wears yellow garments, is bedecked with brilliant ornaments and is dark complexioned like the rich rain bearing clouds. In +: beauty, He easily surpasses Kandarpa (the God of ‘Love). He is seated on the eight petaled red lotus, “ The monosyliable sound of Krishna's flute is “OM”. --- ## Page 206 200 { Vedic Remedics in As trology which is supported on a magnificent pedestal studded with various gems under the Kalpavriksha (wish fullfilling tree). Cows, cowherds and their women as well as Muni’s® throng around Him. This Pooja is normally done on Tuesdays and Fridays. ii) Mantra . ` Choose any of the following mantras for Japa. The rules given in an earlier chapter do not affect the , Mantra of Sri Krishna. This is the only exception to the rules. It maybe noted that Krishna mantra could automatically give results merely by performing the Kesavakirtyadi Nyasa. Adding the Rama beeja (Shrim) gives worldly comforts and fame whereas adding the Maya beeja (Hrim) gives emancipation from the cycle of rebirth. After meditating on Krishna, this mantra should be recited one-lakh times, with one-tenth for Yagna/ fire sacrifice. The eight-petal copper-lotus should be offered to Sri Krishna. In the eight petals, worship the eight queens by offering vermilion (red sindoor) ` in a clockwise manner starting from the eastern petal. Thereafter, worship the eight principal Bhakta (disciples) by offering Red Sandal paste followed by the ten Digpala (guardians of the directions). Whereas the mantras of eight queens have the Rama Beeja (Shrim), the mantras of the eight Bhakta have the Maya Beeja (Hrim). (a) Dasakshari Gopala Mantra गोपीजनवल्लभाय स्वाहा : Gopijanavallabhaya Swaha (b) Dwadasakshari (12 Syllable mantra of Gopala) Brahma Rishi ® Bald mendicants dedicated to the service of Krishna and vowed to a life of celibacy. They alone are allowed to climb atop a temple for ifs repair or mainte- fiance. --- ## Page 207 Compendium of Mantra ` ` 201 ' श्र हीं क्लीं कृष्णाय गोविन्दाय स्वाहा | Shrim Hrim Klim Krishnaya Govindaya Swaha. (c) Jagannatha Trayodasakshari हीं श्रीं कली कृष्णाय जगनधाय स्वाहा | Hrim Shrim Klim Krishnaya Jagannathaya Swaha (प) Astadasakshari (18 Syllable mantra of Gopala) क्लीं कृष्णाय गोविन्दाय गोपीजनवल्लभाय स्वाहा | Klim Krishnaya Govindaya Gopi-Jana-Vallabhaya Swaha. हर (९) Gunjamala Mantra ॐ कृष्णं तुभ्यं नमह | । ` ` . Om Krishnam Tubhyam Namah (f) Gunjara Mantra ॐ गुण्जरा गोपीजनवल्लभाय स्वाहा | Om Gunjara Gopi-Jana-Vallabhaya Swaha

03553 श्री रूविमण्ये नम | Om Shrim Rukminyai Namah (E) ॐ श्री सल्यभामायै नमः । | Om Shrim Satyabhamayai Namah (SE) ॐ श्री नग्नजित्तये नम | Om Shrim Nagnajityai Namah (5) . ऊँ श्री कालीन्दयै नम | Om Shrim Kalindyai Namah (ए) ॐ ओं मित्रविन्दायि ans | Om Shrim Mitravindayai Namah (W) ॐ of सुलक्षणाय नमः । Om Shrim Sulakshanayai Namah (NW) ॐ ओं जाम्बवत्यै नमः | Om Shrim Jambavatyai Namah (N) ॐ श्रीं सुशीलायै नक | Om Shrim Sushilayai Namah (NE) EE 5-7:Mantra for the Eight Bhakta ॐ हीं वसुदेवाय नमः | Om Hrim Vasudevaya Namah (E) दि ॐ हीं देवकये नमः | Om Hrim Devakyai Namah (SE) ॐ हीं नन्दाय नमः | Om Hrim Nandaya Namah (5) ॐ हीं यशोदायै नम | Om Hrim Yasodayai Namah (SW) ॐ हीं बलभद्राय नमः | Om Hrim Balabhadraya Namah (W) ॐ हीं सुभद्रायै नमः | Ogi वणा Subhadrayai Namah (NW) ॐ हीं गोपेभ्यो नम | Om Hrim Gopebhyo Namah (N) ॐ हीं गोपिभ्यो नमः 1 Om Hrim Gopibhyo Namah (NE --- ## Page 208 202 Vedic Remedies in Astrology The mantra for the ten digpalas can be seen in table _ 5.4. White sandal and white (actually Green) Tulsi leaf is offered to Sri Krishna and Sri shakti on his right side white Red sandal and Red (actually Blackish) Tulsi leaf is offered to Sri Krishna and Blue _ shakti on his left side. Then two tulsi leaves (one ‘green and one black) are placed on his head with two kanera flowers and two lotuses. The ` Panchopachar or Shodasopachar pooja follows this.

petals of the lotus (starting from the east facing petal in the clockwise direction) with the Krishnastaka mantras. Thereafter the Japa is performed.

ॐ यदुश्रेष्टाय नमः | Om Yadushreshtaya Namah ॐ वे्णेयाय नमः | Om Varshneyaya Namah ॐ धर्मसंस्थापनाय नमः | Om Dharmasamsthapanaya Namah ॐ अमुरकान्तभरहरीणे नम | | Om Asurakrantabharaharine Namah

This Pooja is normally performed on Thursdays and Sundays. Yellow garments, yellow seat (Asana), - yellow forehead anointment (called Kasturi Tilak), yellow sweets etc. are to be used for the Deity and by the worshipper as well. A yellow Sapphire ring ` in gold is also worshipped at the center of the Yantra . that is later worn in the right hand ring finger (fourth finger from thumb and NOT in the index finger). . । --- ## Page 209 Compendium of Mantra 203 i) Dhyana कदम्ब मूले गायन्तं गोपालं चनमालिनम्‌ | कदंब कुसूमेर्जुष्ठं चिन्तयिला जनार्धनम्‌ | Kadamba Mule Gayantam Gopalam Vanamalinam Kadamba Kusumerjustham Chintayitwa Janardhanam. ii) Tilak (Vermillion etc. offering) Offer vermilion (red Sindoor) dots with the right hand middle finger on the four doors of the yantrs saying “Shrim” and the mantra’s of the Guardians. ` Similarly, offer red sandalwood paste (Rakta Chandan) to the eight petals of the lotus saying “Hrim” and then the mantras of the digpalaka. Thereafter offer white sandalwood paste on the triangles saying “Kleem” and yellow paste at the center saying “Om”, The relevant mantra’s can be learnt from a Guru or the standard texts. iii) Abhushana Mantra Within the circle of the lotus, but outside the triangles, offer nine red vermilion dots while reciting each of the following mantra.

Om Kiritaya Namah Om Kundalaya Namah { 3 ॐ SEH नम Om AnGadaya Namah ॐ पद्माय नम । Om Padmaya Namah ॐ अंकुशाय नमः Om Ankushaya Namah ॐ धनुशाय नमः | Om Dhanushaya Namah ॐ शराय नम | Om Sharaya Namah ॐ शंखाय नमह | Om Sankhaya Namah ॐ चकाय नम | Om Chakraya Namah --- ## Page 210 204 Vedic Remedies in Astrology iv) Rasi Mantra” The Janma Rasi is the sign occupied by the Moon in - the birth chart. If this is not available, then the Rasi should be determined from the starting letter of the name. Rasi suddhi is done by offering water, pearl etc. to Krishna and reciting the Rasi Mantra. Going to Vishnu/ Krishna purifies the mind. Only then can our hearts be pure for receiving Him.

ॐ विष्णवे नम | Fy ti

Taurus/ Vrisab | ॐ वासुदेवाय नमः | Om Vasudevaya Namah Gemini / Mithun} ॐ केशवाय नमः | Om Keshavaya Namah Cancer /Karkata] ॐ राघाकृष्णाव नम | | Om Radha-Krishnaya Namah Leo/Simha ॐ हरिहराय £ Om Hariharaya Balamukundaya बालमुकुन्दाय नम | Namah Virgo/Kanya | ॐ हीं पिताप्वराय Om Hrim Pitambaraya परमात्मने नमः | Paramatmane Namah Libra/ Tula ॐ श्रीराम दाशर्यये कह | | Om Sri Ram Dasrathaye Namah 7 The name “Sammohana” implies an inner relationship with the Mohini Avatar of Vishnu, During the chuming of the Ocean by the Gods & Demons (Koorma-Avatar episode), various gems came forth along with a lot of poison. Being the natural protector of creation and the destroyer of evil, Shiva offered to drink this and save the world from utter destruction. His body started to burn as the poison descended in His neck. Maharshi Atri (one of the Sapta Rishi with the power of Creation) went into deep meditation, which resulted in the birth of the Moen. Thus, the Moon ibelongs to the lineage of Maharshi Ali called Atreya Gotra. The sage placed the Moon on the head of Shiva and the poison receded. Hence, the best remedy for "removing the effects of poisons on the body is to worship Shiva on Mondays in His Somanath form. With the emergence of the Moon came a pot of nectar (Amrita) and Lakshmi (Shri). Thus, all these three are the children of Varuna, the God of the Ocean. This is of important astrological significance as the Amrita Sphuta and Shri Lagna are calcu- laled based on the birth position of the Moon. The Gods and demons stood in separate queues to parlake of the nectar of immortality. The Gods envisaged that by the time they finished drinkige, the pot would be empty. One of the demons got scent of the scheme and disguising himself as a God, changed the queue. Surya, the Sun God, soon spotted him, He mentioned this to Chandra, the Moon God. The Moon, at the speed of thought, rushed to Vishnu for help. The Lord appeared as the Mohini avatar and killed the demon by cutting his neck just as he swallowed the nectar. The head and trunk split and were thrown poles apart. They are called Rahu & Ketu respectively. To this day, these paris move in the heavens in the form of two points trying to meet. The Rasi Mantra plays an important role in taking the mind to Vishnu/Krishna. --- ## Page 211 Compendium of Mantra - 205 ई / ॐ नारायणाय नम | Om Narayanaya Namah Vrischik* ॐ नराय नमः । Om Naraya Namah Sagittarius/ ॐ हीं श्रीं कीं धरणी | Om Hrim Shrim Krim Dharani Dhanus धराय नम | Dharaya Namah Capricorn/ ॐ श्री वत्सलाय नम | | Om Shrim Vatsalaya Namah Makar

FEATS TW | Achyutaya Namah Kumbha* ॐ att गेचिन्दमोपालाय | Om Klim Govinda-Gopalaya TH | Namah Pisces/Meena | ॐ को tei चक्राय Om Krim Rathanga-Chakraya नम | Namah * Two mantra have been given for the two lordships of these signs. The first mantra is for the node {(Rahu/Ketu) while the second is for the planet (Saturn/Mars) for the signs Aquarius and Scorpio respect ively. v) Japa Mantra ॐ सं सम्मोहनाय कृष्णाय भद्राय ॐ फट्‌। Om Sam Sammohanaya Krishnaya Bhadraya Om Fhut 4) OTHER RELATED MANTRA"S a) Mayura Mantra ॐ श्याम श्याम विचित्र पक्षी नमः) : Om Shyam Shyam Vichitra Pakshi Namah b) Mukuta Yantra (& Mantra) The Mukuta Yantra is drawn and fixed inside the crown of Sri Krishna. Worshipping Sri Krishna while He wears this crown removes all obstacles and ‘Sakata Yoga™' is broken and converted into ‘Mukuta Yoga’. ॐ हरि ब्रह्म वसनाय नम | Om Hari Brahma Vasanaya Namah "Sakata Yoga: Placement of Jupiter & Moon in mutual 2/12 or 6/8 houses causes Sakata Yoga. Eother of them in strength and in a quadrant from the ascendant resulls in the breaking of the Sakata Yoga, which results in Mukuta Yoga. Thus, due to the Sakala Yoga the native has to face many obstacles in his good enterprise, but when the yoga breaks it crowns him with success and fame. --- ## Page 212 206 ` Vedic Remedies in Astrology | Figure 5-8: Mukuta Yantra ¢} Sankha Yantra (& Mantra) The conch is held in the left hand of Vishnu/ Krishna/Jagannath. The worship of the conch has been given in detail separately. The Jagannatha Trayodasakshari Sankha Mantra (13 letter conch mantra of Sri Jagannatha) protects the worshipper from all kinds of evils, premature death, diseases ` etc. It is drawn on a right handed Conch and wor- shipped. The blowing of the conch dispels all evils. ॐ जय जय जगन्नाथ नमाम्यहं । Om Jaya Jaya Jagannatha Namamyaham

--- ## Page 213 Compendium of Mantra | 207 d) Sudarshana Yantra (& Mantra) for protection i) Dhyana नारायण परादैव नारायण पराक्षरा | ` नारायण परामुक्ति नारायण परागति | 11 राम नारायणानन्त मुकुन्द मधुसूदनम्‌ | कृष्ण केशव कम्सारे हरे चैकुण्ठ वामनम्‌ | 12 ` हो मुरारे मधुकैटभारे गोपाल गोविन्द मुकुन्दसौरे | यज्ञेशनारायण कृष्ण विष्णु निराश्रय मां जगदिशरक्च | 13 Narayana Paradeva Narayana Parakshara Narayana Paramukti Narayana Paragati Rama Narayananta Mukunda Madhusudanam Krishna Kesava Kamsare Hare Vaikuntha Vamanan. Hare Murare Madhu Kaita Bhare Gopala Govinda Mukunda Soure , Yagyesha Narayana Krishna Vishnu Nirasraya Maam Jagadesha Raksha. ii) Mantra (To be recited using Sphatik crystal Rosary) ॐ क्लीं कीं ए सुरक्षा साधय सुदर्शनाय फट्‌। Om Klim Krim Aim Suraksham Sadhaya Sudarshanaya Phut | iii) Description Shiva created & gifted this weapon for Vishnu/ Krishna. Parvati sits at the center in the female symbol of a triangle with its apex facing down and Shiva sits with Her in the male symbol of a triangle (apex facing upwards/East). Thus, these two triangles superimposed symbolize the Yoga of creation called “Hiranyagarbha” or the Golden Embryo and the Shiva Linga. The Sapta Rishi’s (seven seer’s forming the fountain head of Sanatana Dharma of the Hindu’s) are seated in Padmasana around the Yogic triangles in perfect Samadhi. They symbolize the seven colors” that merge into the १ Vedic Astrology teaches that these are the seven bodily planets from the Sun to Saturn representing the colors as follows: Mars-Red, Sun-Orange, Jupiter-Yellow, Mercury-Green, Venus-Blue, Moon-Indigo & Saturn-Vielel --- ## Page 214 208

Saturn representing the colors as follows: Mars-Red, Sun-Orange, Jupiter-Yellow, Mercury-Green, Venus-Blue, Moon-Indigo & Saturn-Vielel --- ## Page 214 208

white light. Qutside of this is the eight-petal lotus of “Kala” (personified time) showing that the entire . creation is a timeless cycle that is perfectly ordained. The twelve “Aditya” (personified Sun in twelve zodiacal signs) sitting on the twelve-petal lotus surround the eight-petal lotus and govern all creation in its evolution. They represent the external ` ण material manifestation of the creation. This is a very important concept in Yantra Siddhi in that the lotus with petals lesser than eight represent the “Soul” or Atma level while lotus with petals more than eight represents material creation. Hence, eight-petal lotus is the threshold or the meeting point between the outer material creation ` (or body covering) and the inner soul and is the “Mana” or mental level. Working through the veil of the eight-petal lotus™, each of the Sapta Rishi’s has yoga with each of the Sun signs (Aditya) forming the vital creative division called Saptamsa (Hence, the Saptamsa D-7 chart is studied for progeny and creation). Thus, in a sence, the real father or creator is the Rishi (Seer) from whom the spark of the individual soul has emerged and this leads to the concept of GOTRA or lineage which is traced back to these Rishi’

7 The particular petal that guides the light of the soul (emerging from a particular Rishi) for ils material creation represents the Chara Atmakaraka and becomes the King or Controller of that creation during ils period of existence. --- ## Page 215 Compendium of Mantra ` 209 After the creation of the physical bodies, the twelve Aditya govern and sustain them. Thus, for a healthy body, Sri Krishna advised Arjuna to regularly worship the Aditya (Aditya Hridaya Stotra). The ` Mantra of the twelve Aditya isat Para 4.. The eleven Rudra, who like eleven strong elephants bind the soul to the body, protect these material / physical bodies from destruction and decay. Death occurs when one of these elephants falls or turns away. The trident of lord Shiva called “Trishoola™"” symbolizes them. Finally, the foor doors are guarded as shown by the dark heart shapes. This Yantra requires the worship of the Shivalinga, Divine Mother, Seven Maharishi, Eight-petal Lotus, Twelve-Aditya, Eleven Rudra and the Guardians of the four doors of the Shiva Peetham. Finally, it is offered to Sri Krishna by placing it along with the Sankha Yantra over the Krishna Yantra (see Fig). Figure 5-11:Sri Krishna offered the Sudarshana & Sankha Yantra. ® These “Trishoola” look like the Sanskrit “A” syllable (म), which is the Beejakshara mantra for protection and is outside of the twelve-petal 05, --- ## Page 216 210

~~ €) Removal from Bondage ~~ . i) Types of bondage The scriptures describe three kinds of bondage called “Vira Bandha”, “Naga Bandha” and “ Ahi Bandha” (Bandha means bondage). (a) Vira Bandha It is the bondage caused by enemies and ones own weaknesses (Shadripu) and is attributed to Saturn. This can be due to curses of past / present birth and ‘the person is overpowered and made immobile either by enemies or disease or some other weakness like sex, alcohol etc. The best remedy for Vira-bandha is the Gopala Mantra (or Bala-Gopala Mantra). This is the most common type of bondage. Any mantra ` of Krishna is very helpful. The Krishna Beesi Yantra & Mantra are also very effective. The numbers in the yantra show the order in which the letters are written & offered sandalwood paste. The basic point is that the movement should be from one square/ triangle to another when they have a common side or corner.

--- ## Page 217 Compendium of Mantra दे "211 - Mantra श्री कृष्ण शरणं मम | 1/2... (1. // 9/1. 0 (9) Naga Bandha . . 115 attributed to Rahu and is seen when a person is cheated, falsely accused or falls into terrible times. Posession by spirits, withcraft and black magic are also forms of Naga Bandha. Signs and planets associating with Rahu show the bondage and the person may become a criminal. The best remedy for Naga Bandha is the Rama Taraka Mantra. Any mantra of Sri Rama or simply chanting His holy name removes this bondage. The Rama Beesi Yantra & Mantra are also very effective Figure 5-13:Ram-Beesi Yantra

Prarthana Mantra

SriRamachandracharanou Sharanam Prapaddhai Mantra श्री रामं शरणं मम।

(c) Ahi Bandha It is attributed to Ketu and shows sudden results like reversals, decline in health for no apparent --- ## Page 218 212

reason, insomnia, mental disorders etc. Posession by Graha/other evil spirits, cheating or being cheated, false hopes and self destruction are its symptoms. The best remedy for Ahi Bandha is the Narayana Mantra. Any mantra of Vishnu is very helpful. The Astakshari and beesi Yantra are given below:

Figure 5-14: Vishnu Beesi Yantra

श्रीमन्नारायणचरणे शरणं प्रपद्ये | SrimanNarayanaCharanai Sharanam Prapaddhai Mantra ॐ नमो नारायणाय |

It is possible that in anextreme case, a person maybe afflicted by two or more of these bondage. The fol- lowing procedure is advised: ii) Pacify the cause of the bondage The cause of the bondage is pacified by the following mantra: ॐ अहिबन्ध नागवन्थ दीरबन्ध नमः | Om Ahibandha Nagabandha Veerabandha Namah iii) Recite the Vajrakaccheti Vimsakshari Mantra This twenty-syllable mantra removes the bondage and water purified with this is to be drunk as nec- tar. It is to be recited 20,000 times within 40 Days ॐ श्री अनन्त नमाम्यहम। --- ## Page 219 5.9. 1) Compendium of Mantra ` 213 ॐ श्रीं वजकाछेटि श्री ॐ नमः । | ` Om Shri Ananta Namamyaham

iv) Janaka Shadakshari हरे राम कृष्ण . Hare Ram-Krishna a) This mantra has the three names of Narayana (Hari), Rama and Krishna and removes the bondages of all kinds. Recite this mantra and also meditate with this mantra to obtain quick release. HANUMAN

Mantra (12 Syllable mantra)[Ramachandra Muni] हौ हश्फी खफें हश्नों हश्क्फे हसौ हनुमते नमः | Transliteration : Haum Hasphreem Khaphrem Hsraum Haskphrem Hsaum Hanumate Namah. Meditation बालाकर्युतते जसंत्रिभुवनप्रक्षो भक॑ सुन्दरं सुगीवादिसमस्तवानरगणै संसेव्यपादाम्बुजम्‌ | MENT समस्तराक्षसगणान्सत्रासयन्तं प्रभुं श्रीमद्रामपदाम्बुजस्मृतिरतं ध्यायामि वातात्मजम्‌ | | Transliteration: Balarkayutatejasamiribhuvanapraksobhakam sundaram . _ Sugrivadisamastavanaraganaih samsevyapadambujam, Nadenaiva samastaraksasaganansantrasayantam, Srimadramapadambujasmrtiratam ~~ dhyayami vatatmajam. Translation: I meditate on Hanuman with lustre of ten thousand . rising Sun's. He, the son of the Wind God controls the three worlds. Sugriva and his host of monkey- --- ## Page 220 214

men serve His lotus feet. His roar terrifies the entire army of the Demons and he is always engrossed in the contemplation of Sri Ram.

Worship of the eight-petal lotus made of copper is essential for this mantra to fructify. The yantra (eight petal lotus made of copper) is placed on a clean flat surface and is offered red vermilion (Sindoor)} with the following eight mantra in a clockwise direction starting from the east-facing petal.

EE रामभक्ताय नमक | । Om Rambhaktaya Namah. (F) ॐ माहतेजाय नमः | | Gin Mahatejaya Namah. (SE) कपिराजाय नमः ¦ । Om Kapirajaya Namah. (8) कं महाबलाय नमः | | Om Mahabalaya Namah. (SW) द्रोणाद्विहारकाय नमः । | Om Dronadriharakaya Namah. (W) ॐ मेरूपीठकार्चनकारकाय नकः | || Om Merupithakarchanakaraya

ॐ दक्षिणाशापास्कराय नम । | | Om Dakshinasabhaskaraya Namah. (N) ॐ सर्वीयिध्ननिवारकाय नमः | Om Sarvavighna-nivarakaya

Thereafter the eight chief Vanara (Lit: monkey -men) who had assisted Hanuman are worshiped in the eight petals (starting from the petal in the east) with the following mantra:

ॐ सुग्रीवाय नम | Om Sugrivaya Namah. (East) ॐ अम्गदाय नमः | _ | . Om Angadaya Namah. (SE) ॐ नीलाय नमः | Om Neelaya Namah. (S) ॐ जाम्बवन्ताय नम | Om Jambavantaya Namah. (SW) ॐ नलाय नम | Om Nalaya Namah. (W) ॐ सुषेणाय नमः । Om Susenaya Namah. (NW) ॐ द्विविदाय नमः | Om|Dwividaya Namah. (N) . ॐ भैन्दाय नम | Om Maindaya Namah. (NE) --- ## Page 221 Compendium of Mantra 215 d) Results 1) Mantra Siddha 15 obtained by 12,000 repetitions and thereafter a fire sacrifice is made with one-tenth (1200) mantra repetitions for attaining Siddhi™. A Havana (fire sacrifice) of 1000 mantra can ward off the evil spirits, thieves, legal problems, poison, negative effects of time as indicated by the Dasa and all other evils. Twenty-one Celibates should be fed after the Pooja for best results. 2) a) b) ९). d) €) For removing the poison, water consecrated with this mantra should be drunk. For removing evil spirits, fever etc, holy water should be cupped in the palm and thereafter re- citing the ple if a person called Umakant has to be released from any kind of bondage, then the mantra “हों हश्फीं खफें ह्रौ हश्क्फें हसौ हनुमते TR उमाकान्त विमोचय विमोचय ।” (Haum Hasphreem Khaphrem Hsraum Haskphrem Hsaum Hanumate Namah -Umakanta Vimochaya Vimochaya). Similarly for other ends like captivation, dissen- sion, aversion etc, the Samputa would be “Vidvesaya vidvesaya”, “Ucchataya ucchataya” or “Maraya Maraya”. The items to be used etc can be learnt from ant standard book on Tantra.mantra, it should be sprinkled on the concerned person Black magicians use this mantra in the crema- tion/ burial grounds for capturing a spirit (con- stant repetition of 600 mantra for three nights) . or for killing an enemy (using an idol to repre- sent the enemy). This is a tamasik use of the mantra and the addendum is not being given here. A prisoner is released if on a picture of Hanu- man, this mantra is written followed by his --- ## Page 222 216 2) 3) 4) 5) 6)

name and Samputa (vimocaya vimochaya) and . wiped off with the left hand. This has to be done 108 times for 40 Days.

Pancha Kuta mantra

Transliteration: Hsphrem Khphrem Hsroum Hskhphrem Hsoum.

ऊँ ऐंश्रीं हां हीं हुं हश्फें खफें हश्रीं हश्कफेम हसे | Transliteration : Om Aum Shrim Hram Hrim Hrum Hsphrem Khphrem Hshroum Hsoum. Ekadasakshari (11 letter)- Sattwik ॐ हं EEE नम 1 Transliteration: Om Ham Rudraya Hanumate Namah

नमो भगवते अन्जनेयाय माहाबलाय स्वाहा | Transliteration :Namo Bhagavate Anjaneyaya Mahabalaya Swaha. Note: By adding the Pranava (Om) the mantra becomes very Satwik and is recommended for daily practice.

This is a Tantrik form of hanuman. The five heads represent the five elements of Prithvi (Solid/ Earth), , Jala (Liquid/ Water), Vayu (Wind/ Gaseous state), Akash (Vacuum/ Sky) and Agni (Fire/ Energy). East Facing Mantra = + $ = ५ स्याहा | के Siddhi: Proficiency in the mantra; this is a kind of expertise and familiarity of the " mantra obtained by a certain minimum number of repetitions followed by a Havana (Fire Sacrifice). --- ## Page 223 i. ` Compendium of Mantra 217 Om Purvakapimukhaya Panchamukha Hanumate Tam Tam Tam Tam Tam Sakalasatru Samharanaya Swaha. [Eradication of enemies, law suits and fear of Violence etc] 15000 repetitious. South Facing Mantra ॐ दक्षिणमुखाय पञ्चमुख हनुमते करालबदनाय नारसिंहाय ॐ हं हीं हूं हों ह सकलभूतप्रेतदमनाय स्वाहा | | Om Dakshinamukhaya Panchamukha Hanumate Karalabadanaya Narasinchaya Om Hram Hrim Hrum Hroum Hrah [10,000 repetitious to completely remove black magic, spells, evil spirits etc.

५ = ० = » स्वाहा |

स्वाहा |

d) Hanumate Mam Mam Mam Mam Mam Sakala Vishaharaya Swaha. [10,000 repetitious facing west within 40 days will remove the evil effects of all poisons and ensure good health, All forms of addiction are removed with this mantra] |

ॐ नमो हनुमते रूद्वावताराय पञ्चबदनाय उत्तरमुखे आदिवराहाय सकल समपत कराय रामदूताय स्वाहा । | Om Namo Hanumate Rudravataraya Panchabadanaya Uttaramukhaya Adivarahaya Sakala Sampat Karaya Ramadutaya Swaha. [50,000 repetitious of this mantra facing North bestows great wealth and prosperity]. All the above mantra are normally recited at night. --- ## Page 224 218 5.10.

SHIVA

a) Rudra Dasakshari Mantra (Baudhayana Rishi, Pankti Chhanda, Rudra D=vata). i) Mantra ` ॐ नम भगयते दाय |

` ii) Dhyana छ केलासाचलसन्निभं त्रिनयनं पठ्चास्यमम्बायुतं - नीलगीवमहीङभूषणधर व्याप्रत्वचापरावत्तम्‌ | अक्षप्रगवरद्युण्डिकाभयकर्‌ चारी कलां बिभ्रतं गडगांभोविलसज्जर दभुजं वन्दे महेश परम्‌ | | Kailassacalasannibham trinayanam pancasyama- mbayutam Nilagrivamahisabhusanadharam vyaghratvacapravrtam, Aksasragvarakundikabhayakaram candrim kalam - bibhratam Gangambhovilasajjatam dasabhujam vande mahrsam Param : Worship Rudra to end enmity Prepare a square pedestal of white rice and draw the Mahakala Chakra init. Established aShiva Linga ` हां its center (Black Color) and mediate on Lord Shiva. ` 1) Dhyana: प्रचण्ड प्रकृष्टं प्रगल्मं प्रशं अखण्ड अनं भानु कोरि प्रकाशं | त्रय शूल निर्मूल नं शूलपाणि भजे अहं भवानीपति भावगमयं | | Prachanda Prakrishtam Pragalbham Paresham Akanda . Aanam Bhanu Koti Prakasham. Trayah Shoola Nirniula Nam Shoolapani Bhaja Aham Bhavanipatim Bhavagamyam . ii) Mantra Thereafter light a lamp of oil and offer 151 black chili to --- ## Page 225 ० Compendium of Mantra 219 Lord Shiva with the following mantra (to be recite 151 ` times) ॐ श शत्रुनाशाय रूद्राय फट्‌ | Om Sam Satrunashaya Rudraya Phut

The eighth lord from any sign is the Rudra. Thus, there can be twelve Rudra for the twelve zodiac signs. However, the eighth Lord from the Atmakaraka qualifies as Maheshwara and in ...exceptional circumstances as given in the Upadesa * Sutra of Jaimini Maharishi, another may take its place. Thus, of the twelve Rudra, one will always take the role of Maheshwara or Shiva with the responsibility of delivering the soul. This leaves ` ` eleven Rudra that if weak, can cause premature death or suffering. The Mantra of these Rudra is listed below - i) Kapali (कपाली) मनर ४ नमस्ते रूद्वमन्यव अती त ईषवे नमः | बाहुभ्यो मतु ते नम । | मन्त्र 8 ॐ हैं हूँ शत्रुस्तम्भनाय हूँ हुं ॐ फट्‌ | Transliteration MANTRA Namaste Rudramanyava Ati-ta Isave namah, Bahubhyo matu-te namah MANTRA Om Hum Hum Satrustambhanaya Hum Hum Om Phut ii) Pingala (पिगल) erg यामि पुं गिरिरान्त हस्ते विभर्यस्तवे | शिवां गिरित्र तां कुख मा हिंसी ` पुरूष जगत्‌ | मंत्र! ॐ श्री हीं श्रीं सर्व मंगलाय पिगलाय ॐ नमः । | Transliteration: - MANTRA Yami Shum Giriranta haste Vibharyastave Shivam giritra tam kuru Ma Himsih Purusham Jagat MANTRA Om Shrim Hrim Shrim Sarva-Mangalyaya Pingalyaya Om Namah --- ## Page 226 220

iii) Bhima (भीम) मंत्र शिवेन्‌ चचशा त्यया गिरिशाच्छ बदामसी यथानः सर्यवमित्य गदय क्षम्‌ सुमना असत्‌ मत्र ॐ UU मनोवाज्चित Rega dd ॐ । । ` Transliteration: MANTRA Shivena Vachasa twaya Girishachcha Badamasi Yathanah Sarvavamitya gadaya Kshama Sumana Asat

Aim Aim Om iv) Virapaksha (विखपाक्ष) मत्र अथ्यवीचदधिवक्ता प्रथमो देव्यो भिषक३$ | अम्हीश्च सर्व जम्भयन्त यातु ध्यान्योधराचिः पुरासूव । मंत्रः ॐ ख्द्वाय रोगनाशाय आगच्छ रं ॐ नमः । Transliteration: MANTRA AthyavichadadhiVaktya Prathamao Devyo , Bhishakah. Amhischa SarvaJambhayanta Yatu DhyanyoDharachih Purasuva MANTRA: Om Rudraya Roganashaya Aagachcha Ram Om Namah v) Vilohita (विलोहितः मत्र असौ जौ प्रवसर्पति नीलगीवो विलोहित | उतैन्‌ गोपा अदृशर्न दृन्तुदहार्यः स दुस्टो मृडयातिनह | | मंत्र उँ श्री हीं सं सं हीं श्री संकर्षणाय ॐ Transliteration: MANTRA Asou Jou pravasarpathi Neelagrivo Vilohita. ` UHaina Gopa Adrisandrintudaharyah Sa Dristo Mridayatinah. . MANTRA: Om Shrim Hrim Sam Sam Hrim Shrim | Sankarshanaya Om --- ## Page 227 Compendium of Mantra ` 221 vi) Shastha (सास्ताः) ! मतरः अमरौ यस्ताग्रो अरूण SAE सुमंगलः ये चैन गु षूद । अमितोदिक्षुथताः सहस्र शोजवैषा हेड ईमहे । | । मंत्र; ॐ हीं हीं साफल्याये सिद्धये ॐ नमः | Transliteration ~: MANTRA 450४ Yastagro Aruna Utababhuh Sumangalah Ye chaina Gu Rudra AmitoDikshuSritah Sahasra Sojavaisha Ide Imahe . MANTRA: Om Hrim Hrim Safalyayai Siddhaye Om ‘Namah vii) Ajapada (अजपाद) मंत्रः नमस्ते नीलगीवाय सहशाक्षाय मिदुषे अथोये अस्य सत्यातोहन्तेभ्यो अकरनमः । । मंत्र ॐ श्री बं सौः बलवर्धनाय बलेश्वराय रूद्वाय फट्‌ Transliteration MANTRA Namaste Neelagrivaya Sahasrakshaya Midushe Athoye Asya SatyatoHanteBhyo AkaraNamah. MANTRA: Om Shrim Bam Souh Balavardhanaya Baleswaraya Rudraya Phut viii} Ahirbudhanya (अदहीरबुदधन्य) . त्रः प्रमुखं धन्यन्सुमुभयोरान्तर्या यम्‌ । षाश्चते हस्त ईषवः पराता : भगवो बप्‌ | ' मंत्र ॐ हां हीं हुं समस्त ग्रहदोष विनाशाय ॐ । Transliteration: MANTRA Pramukham Dhanyansumu Bhyora- ntaryaYam Paschate Hasta Isavah Parata Bhagavo Bap. MANTRA: Om Hram Hrim Hum Samasta Graha Dosha Vinashaya Om --- ## Page 228 222

ix) Sambhu (शम्मुद्) . ` मंत्र: या ते हेतिर्मीष्टम्‌ हस्ते बभुवते धनुः । तयास्मान्‌ विश्वत्‌ स्तवमय क्षमया परिभूजा । | मंत्र ॐगंग्लो सों ग्लो गं ॐ नमः । Transliteration: MANTRA Ya te Hetirmistam Haste Babhuvate Dhanuh. Tayasman Viswat Stavamaya Kshamaya Paribhuja.

Namah x) Chanda (चण्ड) Wh अवतत्य धनुष्टव्‌ सहसाक्ष शतेषुधीः । निशीर्य शल्यानाम्भुक्षा शिवो न सुमना | | मत्र ॐ चं चण्डीश्वराय तेजस्याय चं ॐ फट्‌ Transliteration: न MANTRA Avatatwa Dhanustava Sahasraksha Sateshudhih Nishirya Salyanambhuksha Shivo Na Sumana Bhava MANTRA: Om Chum Chandiswaraya Tejasyaya Chum Om Phut ix) Bhava (भवौ मंत्र ४ नम्स्ते आयुधायाना तत्ताय guid । उभाम्यामूत्‌ ते नमः ` बाहुभ्यामत्रवधन्यते | | _ मत्र ॐ भवोद्‌ भवाय संभ्वाय ईष्ट दर्शन हेतवे ॐ शं ॐ नमः | Transliteration: MANTRA Namaste Ayudhayana Tataya Ghrirnave. Ubhamyamut TeNamah Bahubhya Man- tra Vadhanyate

MANTRA: Om Bhavod Bhava Sambhavaya

Namah --- ## Page 229 Compendium of Manira 223

a) Sadasiva Mantra (Vamadeva Rishi) Pankti Chhanda Sadasiva Devata ॐ हीं mw | OM HAUM SAH. b) Mrityunjaya Beeja Mantra (Kahola Rishi) Gayatri Chhanda Mrityunjaya Devata Hw - Om Jum Sah. ¢) Mrityunjaya Mantra (Vedic) (Vasistha Maharishi) Rig Veda VII 5 [Anusthup ` Chhanda Rudra Devata.] - (a) Mantra: ॐ प्रयंबकर यजामहे सुगन्धिम्‌ पुष्टिवर्धनम्‌ | उर्वशूकिमिव बन्धनाम सृत्योमेक्षिय मामृतात | | | Om’ Tryambakkam’ Yajamahe”® Sugandhim’ Pustivardhanam® * OM is not spelt out in the Rig-Veda, but has to be added to the beginning of all Mantras as given in an earlier Mantra of the Rig-Veda addressed to Ganapati. 7 TRYAMBAKKAM refers to the Three eyes of Lord Shiva. ‘Trya’ means “Three” and ‘Amhakam’ means eyes. These three eyes or sources of enlighten- ment are the Trimurli or three primary deities, namely Brahma, Vishnu and Shiva and the three ‘AMBA’ (also meaning Mother or Shakli’ are Saraswati, Lakshmi "and Gouri. Thus in this word, we are referring to God as Omniscient (Brahma), Omnipresent (Vishnu) and Omnipotent (Shiva). This is the wisdom of Vashistha Maharishi and is referred to as Sri Datlatreya having three heads of Brahma, Vishnu and Shiva. + क YAJAMAHE means, “We sing Thy praise”. + SUGANDHIM refers to His fragrance (of knowledge, presence and strength "i.e. three aspects) as being the best and always spreading around. Fragrance refers to the joy thal we get on knowing, seeing or feeling His virtuous deeds. * PUSTIVARDHANAM: Pooshan refers to Him as the sustainer of this world and in this manner, He is the Father (Pater) of all. Pooshan is also the immer impeller of all knowledge and is thus, Savitur or the Sun and also symbolizes Brahma the Omniscient Creator. In this manner He is also the Father (Genitor) of all --- ## Page 230 224 Vedic Remedies in Astrology Urvarookamiva® Bandhanaan® Mrityormoksheeya® Maamritaat®. Translation:O! Three-eyed Lord Shiva (three luminous eyes represent the Sun, Moon and Holy fire) we worship Thee, Thy (name & fame) spreads like sweet fragrance as Thou art the savior of all beings. 1 am under the bondage of dreadful diseases (of the mind, body and soul) and pray that Thou shalt deliver us from (all evils including) death (for the sake of immortality) by granting us some life rejuvenating nectar. (b) Dhyana हस्ताभोजयुगस्थकुम्भयुगलदुदधृत्यतोयरिर सिज्चन्तं करयो्युगेन दधतं स्वांके सकुम्भीकरी | अक्षस्इ्मुगहस्तमम्बुनगतंमूर्खस्थयन्दम्रवतपीयूषोनतन्‌ं भजे सगिरिजं मृत्युञ्जय त्रयम्बकम्‌ | | Hastambhojayugasthakumbhayugaladuddhrtyatoyamsirah Sincantam karayoryugena dadhatam svanke sakumbha- ukarau, | Aksasranmrgahastamambujagatam murddhasthacanda- Sravatpiyusonnatanum emirate ~ S'URVAAROKAMEVA: "रपद" means “VISHAL” or big and powerful or deadty. ‘AARDOKAM' means ‘Disease’. Thus, URVAROOKA means deadly and overpower- . ing diseases. (The CUCUMBER interpretation given in various places is also correct for the word URVAROQOKAM, but not apt for this mantra). The diseases are also of three kinds caused by the influence (in the negative) of the three Guna’s and are ignorance (Avidya etc), falsehood (Asat etc as even though Vishnu is everywhere, we fail fo perceive Him and are guided hy our sight and other senses) and weaknesses (Shadripu etc. a constraim of this physical body and Shiva is all powerful). 2 BANDANAAM means bound down. Thus read with URVAROOKAMEVA, it means ‘I am bound down by deadly and overpowering diseases (of the body, mind & soul)’. ४ MRITYORMOOKSHEYA means to deliver us from death (both premature death in this Physical world and from the never ending cycle of deaths due to re-birth) for the sake of Mokshya (Nirvana or final emancipation from re-hirth). ५ MAAMRITAAT means ‘please give me some Amrita (life rejuvenating nectar). Read with the previous word, it means that we are praying for some ‘Amrita’ to get out of the death inflicting diseases as well as the cycle of re-birth. --- ## Page 231 Compendium of Mantra , ` 225 bhaje sagirijam mriyunjayam tryambakam . €} Remarks After performing the mantra Japa and Havana etc, a few drops of Castor Qil are orally administered to the patient while reciting the following mantra: ॐ नमः परम्‌ब्रहम परमालने “ अमुक “ शरीरं कु कुरू स्वाहा | Om Namah Parambrahma Paramatmane “ Amuka” Sareeram Kuru kuru Swaha. [Replace the word ^ Amuka” with the name of the patient]. Cure will begin quickly and surely. Perform a havan of 108 Sanjivani Mantra using twigs of Guduci (4 fingers in length) on the day of the Janma Nakshatra, 10% or 217 Nakshatra. This results in (व) destruction of disease and enemies (b) gain of wealth and (c) long life with sons and grand- sons respectively. This mantra is from Dattatreya Tantra] To prevent untimely premature death or cure from dangerous disease the Havan Samagri should be of Durbha grass®. Here, three blades of Durbha grass blades are offered after each recitation of the mantra. Using Sesame seeds for Havana Samagri makes a person more religious and destroys enmity Khira (Sweetmeat of Rice cooked in thick milk) offered at Havana restores wealth, fame & lustier and offered at Havana destroys effects of Black magic and saves one from controversies. (10,000). The benefits of using different kinds of wood have been given in the standard texts, but it is this authors opinion that ultimately it is the sincerity of prayer that counts. In the case of extreme danger or if the evil is strong, then the person performing the Pooja should protect himself by drawing two Mritunjay-asana Yantra and place them facing each other under his Asana © It removes the evil effects of Rahu representing Jamadagni (Fire of hell). --- ## Page 232 226

this Physical world and from the never ending cycle of deaths due to re-birth) for the sake of Mokshya (Nirvana or final emancipation from re-hirth).

Read with the previous word, it means that we are praying for some ‘Amrita’ to get out of the death inflicting diseases as well as the cycle of re-birth. --- ## Page 231 Compendium of Mantra , ` 225 bhaje sagirijam mriyunjayam tryambakam . €} Remarks After performing the mantra Japa and Havana etc, a few drops of Castor Qil are orally administered to the patient while reciting the following mantra: ॐ नमः परम्‌ब्रहम परमालने “ अमुक “ शरीरं कु कुरू स्वाहा | Om Namah Parambrahma Paramatmane “ Amuka” Sareeram Kuru kuru Swaha. [Replace the word ^ Amuka” with the name of the patient]. Cure will begin quickly and surely. Perform a havan of 108 Sanjivani Mantra using twigs of Guduci (4 fingers in length) on the day of the Janma Nakshatra, 10% or 217 Nakshatra. This results in (व) destruction of disease and enemies (b) gain of wealth and (c) long life with sons and grand- sons respectively. This mantra is from Dattatreya Tantra] To prevent untimely premature death or cure from dangerous disease the Havan Samagri should be of Durbha grass®. Here, three blades of Durbha grass blades are offered after each recitation of the mantra. Using Sesame seeds for Havana Samagri makes a person more religious and destroys enmity Khira (Sweetmeat of Rice cooked in thick milk) offered at Havana restores wealth, fame & lustier and offered at Havana destroys effects of Black magic and saves one from controversies. (10,000). The benefits of using different kinds of wood have been given in the standard texts, but it is this authors opinion that ultimately it is the sincerity of prayer that counts. In the case of extreme danger or if the evil is strong, then the person performing the Pooja should protect himself by drawing two Mritunjay-asana Yantra and place them facing each other under his Asana © It removes the evil effects of Rahu representing Jamadagni (Fire of hell). --- ## Page 232 226

(seat) before commencing the Pooja. The name of “the person should be written in the place of “Sanjay”.

e) Sanjivani Mantra (Mahamrityunjaya Mantra) | This mantra is formed by combinining the three mantras given above. It has three Rishi's Vamadeva, Kahola And Vashistha as well 85 three Chhanda and three devata (Sadasiva, Mrityunjaya and Rudra). Sukracharya the preceptor of the demons used to revive the dead demons using this Mantra. Its life rejuvenating powers are truly incredible and its practice is advised. । ऊँ हैं ॐ जु सः भूर्भुवः स्वः त्रयंबकं यजामहे सुगन्धिम्‌ पुष्टिवर्धनम्‌ ` उर्व्किमिय बन्धनान मृत्योर्माक्षिय मामृतात भूर्भुव स्व रों जुं स$ हैं। ॐ Om Haum Om Jum Sah Bhurbhuva Svah Tryambakkam Yajamahe Sugandhim Pustivardhanam Urvarukameva Bandhanaam Mrityormoksheeya --- ## Page 233 3) a) Compendium of Mantra .227 Maamvritaat Bhur Bhuva Savah Roam Jum Sah Haum Om [Note of caution: This mantra should be done properly with Viniyoga, Rishi Nyasa etc. Else mantra given in Para 2(c) above should be practiced as it is from the Rig Veda and is flawless.]

Shadakshara Sadashiva Mantra (6 Syllable) i) Mantra: ॐ नमः शिवाय

ii) Dhyana: ॐ धाय निल्यं महेशं रजतगिरिनिभं चारूचन्द्रावतंसं रलकल्पाज्यलाप्र परशुमगवराभीतिहसुं प्रसन्न । ... पदमासीनं समन्तात्‌ स्मृतममरघर्ण्येयाधकृलतीं वसानं 0) विश्वादय विश्चव्रीजं निखिलभयहरं पञ्चक त्रिनेत्रम्‌ | Om Dhyaye Nityam Mahesham Rajatagirinibham Charuchandravatamsam Ratnakalpajwalangam Parasumrigavarabhitihastam Prasannam Padmasinam Samantat Smritammaraganyar Vyagrhrakrittim Vasanam Vishwadyam Vishwabeejam Nikhilabhayaharam Panchavakram Trinetram. Panchakshari Mantra. i) Mantra: नमः शिवाय

ii) Dhyana केलासशीसकोणे सुरविटपिततटे स्फारिके.मण्डपे सन्मातडगारातिपीटोपरि परिलसितं सेव्यमानं gies | जानुस्थं वामबाहुं मृगमपि परश ज्ञानमुद्रां वहन्तं --- ## Page 234 228 “Vedic Remedies in Astrology नागोद्यद्योगवेष्टं ददतमृषिगणे ज्ञानमीशानमीडे | | Kailashdrishakone Suravitapitatet Sphatika Mandape Sanmasttangaratipithopari Parilasitam Savyamanam Suradhyoh Janustham Vamabahum Mrigamapi Praasu Gyanamu- dram Vahantam * Nugodhyadhyogavestam Dadatamrishigane Gyana- meshanamidhe

LORD Shiva is normally worshipped in the from of a“Linga” or penis due to the directions of Maharishi Brighu. The union (yoga) of the Linga (Penis) and Yoni (Vagina) is symbolic of the Hiranyagarbha : (Golden Embryo) and the cause of all creation, Tt represents the ultimate source of all life. Represented astrologically, by the sign Cancer and Jupiter, who gets exalted in Cancer. Thus, worshin of the Shiva Linga is the worship of nature. The word “Linga” is derived from the word “Aalaya” as it is the place of residence of all the Deva’s (Deva-Aalaya). शर्वयोनिषु कौन्तेय मूर्तय सम्भवन्त य टासा बंहममहदयोनिरहं बीजप्रद8 पिता । । (Gita 14.4) Sri Krishna teaches the importance of the Linga in the Bhagavat Gita “Of all the bodies (beings both animate and inanimate) evolving from the Yoni’s* the Divine mother is Prakriti (Nature) and Divine ‘Father in the form of Beeja giver Shiva (Linga) am - {^ Thus, the Linga represents the creative principle or the Life principle. Lingaraja is the temple of Lord Shiva is Bhubaneswar’ Orissa (India). The word Lingaraja in composed of two terms “Linga” and “Raja” with the latter being taken from “Rajayoga” ४ Lit, Female Organ and symbolizing the process of creation, --- ## Page 235 —— a wey Compendium of Mantra | न 229 _ meaning “Union with God” (for a deeper spiritual understanding Rajayoga by Swami Vivekananda is - advised). मूले बह्मा तथा मध्ये विष्णु स्त्रिभुवनेश्वर४ | तदुपरि महादेवः प्रणवाख्यः सदाशिवः | | लिडग्देवी माहादेवी लिंडग साक्षान्महेश्वरः | ` तयो संपूजनान्नित्यं देवदेवीश्च पूनितौ । | Mule Brahma Tatha Madhye Vishnu Stribhuvane- shwara ः . . Tadupari Mahadeva Pranavakhya Sadashiva ` Lingadevi Mahadevi Linga Sakshatmaheswara

--- ## Page 235 —— a wey Compendium of Mantra | न 229 _ meaning “Union with God” (for a deeper spiritual understanding Rajayoga by Swami Vivekananda is - advised). मूले बह्मा तथा मध्ये विष्णु स्त्रिभुवनेश्वर४ | तदुपरि महादेवः प्रणवाख्यः सदाशिवः | | लिडग्देवी माहादेवी लिंडग साक्षान्महेश्वरः | ` तयो संपूजनान्नित्यं देवदेवीश्च पूनितौ । | Mule Brahma Tatha Madhye Vishnu Stribhuvane- shwara ः . . Tadupari Mahadeva Pranavakhya Sadashiva ` Lingadevi Mahadevi Linga Sakshatmaheswara

Translation: The base of the Lingam represents Brahma, the middle portion represents Vishnu the Lord of the three worlds (Bhu, Bhuva and Svah). ` Mahadeva is the portion just above the middle and the hemispherical top represents Sadashiva and - Pranava (OM). The base of the Lingam in the form of a yoni is Mahadevi and the Lingam is the perfect symbol of Maheswara. Thus, worship of the Lingam everyday is akin to worship of all the Deva’s and Devi’s (all deities). These five deities {Brahma, Vishnu, Mahadeva (Shiva), Sadashiva (OM) and , Mahadevi (Adi Shakti} are represented by the five parts of the symbol of OM (ॐ) as Brahma is represented by A (आ), Vishnu by उ), Shivaby M (म), Sadashiva by the crescent Moon called “Nada” and Adishakti by the dot over the crescent Moon called “Bindu”¥. Thus, the Sookshma Panchakshari Mantra representing the Linga is A- U- M - Nada - Bindu (ज - उ - 7 - नाद - बिन्दु) which, due to the effect ` 0 Prakriti is transformed into the Sthula Panchakshari mantra Na - Ma - Shi - Va- Ya (नमः । शिवाय). Thus, the Panchakshari mantra is the reposi- --- ## Page 236 ` 230 फ) । Vedic Remedies in Astrology tory of all knowledge as it represents the Pranava (Om) in the form of a Lingam. Mahamedhanandanath (better know is the Jyotish circles as Sri Dukhishyam Patnaik explains that since the Panchakshari Mantra is actually evolved from Prakriti and is in “Sthoola” (bodily) from, it blesses the worshipper with all the bounties of nature but lacks the power to give emancipation. Hence, he advises people to become strong and to give up attachment by using the Sadakshari Mantra (ॐ नमः शिवाय ) listed which has Pranava in the beginning (as per cycle of rebirth. This meaning of the Sadakshari has been explained by the Saint Sri Tulsi Das as: ॐ नम शिवाय गौरीशंकराय माहादेवाय नमो नमः | मदनान्तकाय मुक्तीप्रदाय श्रीगदशंकराय नमो नमः | | Om Namah Shivaya Gourishankaraya Mahadevaya Namo Namah

Namah

“ Om Namah Shivaya” we jointly worship Gouri (Shakti) and Shankar (Shiva) [in the form of the ` 11828]. He is Mahadeva and the destroyer of Madana (Kamadevata or the God of Love symbolic of all desire) thereby giving Mukti (freedom) from the bondage of rebirth as well as sorrow, which stems from desire. By this, he is the reverred Sam- Kara (Sam ~ Mangala or all that is Good And Kara: doer or benefactor).

(used for establishing the Shiva Linga) ॐ नमह पिनाकीने।

87 The “Nada” and “Bindu” or the Dot OVER the crescent Maon is the foundation of all Shakti Cults wherchy the Bindu --- ## Page 237 ~ e)

Pasupati Mantra. (used for bathing before the Pooja) ॐ नमः पशुपतये | ‘Om Namah Pasupataye Mahadeva Mantra. ऊँ नम महादेवाय |

Om Namah Mahadevaya

Shiva Dhanada Mantra

महेशं सुरेशं सुरारार्ति नाशं far] विश्वनाथ विभुत्यग भुषणाम्‌ | विषूपाक्षभिन्दकं चनिहत्नि नेत्रं सदानन्द मीडे प्रभुं पञ्चवकम्‌ | | Mahesham Suresham Sursratir Nasam Vibhum Vishwanatham Vibhutyaga Bhushanam Virupakshabhindarka Vanihatri Netram Sadananda Meedhe Prabhum Panchavakram.

ॐ शं शकराय धनं देहि देहि ॐ | ‘Om Sam Shankaraya Dhanam Dehi Dehi Om (C) ABHISHEK MANTRA गच्छ गच्छ PUA स्वस्थाने परमेश्वर | ममपुजां गृहिलेमां पुनरागमनाय च | । .Gaccha Gachcha Surasreshtho swastane Parameshwara

` The Abhishek mantra is used for the ritual bathing of the Shiva Linga with Ghee, Milk, Curd, Honey and water (called Panchamrita Snana)

(d) Dhyana: निराकार मोठकारमु्तं तुरीयं गिराज्ञान गोतीत्मीशं गिरिशं | करालं महाकालकालं कृपालंगुणाकार्‌ संसारपारं नतोअहं | | Nirakara Mothakaramulam tureeyam Giragyana Gotitamisham Girisham --- ## Page 238 232 ॐ ) k)

Karalam Mahakalakalam Kripalam Gunakar Samsaraparam Natoaham. (e) JAPA MANTRA ॐ क्ली रोगनाशाय फट्‌ |

Om Klim Roganaashaya Phat.

Burn a lamp of sesamum oil and offer sesamum seeds to a picture of Lord Shiva while reciting the first following mantra 101 times. Thereafter recite the second mantra 108 times using rosary of Rudraksha beads for counting. This mantra is recited for fulfilling all desires.

नमः सम्भवाय च मयोभवाय च नमः शंकराय ` च मयस्कराय च नमः शिवाय च शिवतसय च । | Namah Sambhavaya Cha Mayobhavaya Cha Namah Shankaraya Cha Mayaskaraya Cha Namah Shivaya Cha Shivataraya Cha 2 Mantra ॐ ए मनोवज्चितं साधय साधय ॐ Om Aim Manovanchitam Sadhaya Sadhaya Om.

Shiva Gayatri (Rig Veda 1.187.3)

उप न पितवा चर शिवः शिवाभिरूतिभ्ि । मयोभुरदिषेण्यः सखा सुशेवो अद्धयाः । | Upa Nah Pitava Chara Shivah Shivabhirutibhih. Mayobhuraddishenyah Sakha Sushevo Addhayah. Dwadasjyotirlinga Stotra & Mantra 'सौराष्ट्रे सोमनाथं च श्रीशेले मलिल्कार्जुनम्‌ | उज्जयिन्यां महाकालमोडकारममरेश्यम्‌ | | --- ## Page 239 Compendium of Mantra है 233 केदार हिमवत्पृष्ठे डाकिन्यां भीमशकडरम्‌ | वाराणस्यां च विश्वर्श यम्बकं गौतमीतटे | | वेध्यनाथं चिताभुमौ नागेशं दारूकावने | सेतुबन्धे च रमेशं घुश्मेशं च शिवालये । | ` द्वादशितानि नामानि प्रातरूल्याय यः पठेत्‌ । सप्तजन्मकृतं पापं स्मरणेन विनश्यति 1 | एतेषां दर्शनादेव पातकं नेव तिष्टति | कर्मक्षयो भवेतस्य यस्य तुष्टो महेश्वरः | | Saurashtre Somanatham Cha Srishaile mallirkarjunam Ujjainyam Mahakalam Omkaram Mamalleswaram Kedaram Himavatpristhe Dakinyam Bhimashankaram Varanasyam Cha Vishvesam Tryantbbakkam gautami tate Vaidyanatham Chitabhumou Nagesham Darukaviane Sethubandhe Cha Ramesham Ghushmesham Cha Shivalaye Dwadasaitani Namani Pratarutthaya yah pathet . Saptajanma krutam Paapam Smaranena vinasyati . Eitesham darshanadeva patakam naiva tishthati Karmaksheyo bhavetasya Yashya tushtato Maheshwara 4) YANTRA: EiGHT PETAL LOTUS (ASTADALA PADMA) a) Worship of the Eight petal copper lotus, begins with the worship of his eight chief attendants with the following mantra:

ॐ नन्दीणे | Om Nandine Namah (E) ॐ महाकालाय नमह । | Om Mahakalaya Namah (SE) ॐ गणेशाय नमः | Om Ganeshaya Namah (9) ॐ वृषभाय नमः | Om Vrishabhaya Namah (SW) ॐ भृडगीरिटिणी नम | | Om Bhringiritine Namah (W) ॐ स्कन्दाय नमः | Om Skandaya Namah (NW) ॐ उमाये नमः | Om Umayai Namah (N) E ॐ चण्डीश्वराय नमः | Om Chandiswaraya Namah (NE) --- ## Page 240 234 Vedic Remedies in Astrology The Rudra Yantra is far more elaborate with the worship of sixteen, thirty-two and forty petal lotus outside and concentric to eight-petal lotus. This is beyond the scope of this book and can be studied from standard books on Tantra etc.] b) Lord Shiva was the achiever of the eight Siddhi and His worship as the Teacher is symbolic of the per- fection of divinity. These Siddhi are worshipped in ` the eight petals with the following mantras and of- fer of sandal.