Saravali

wetted anfed sfarateafr wafaa sazfa safafrarg area at afafa degafeinara aig: & oe safe ERAT: un 1. Glory to the Sua God, whose very breathing causes Creation in this world, with whose rising all the animals (living beings) wake up (from the sleep of their ignorance), whose state at the head (i.e. zenith) accentuates all activities (throws the brightest light on one’s wisdom) and whose setting (absence or weakness) causes all to sleep, Such Sun God has his efficacy spread (all over). Notes: Most of the astrological savants in recognition of the importance of the Sun, praise him in the beginning of their works. Kalyana Varma, the king-astrologer, throws light on the Sun’s importance in all daily walks of life. The Sun’s rise releases one of his night sleep and imparts’“‘creation”” * in his daily activities. Similarly, if the Sua, at birth, is on the east, he bestows creative power on the fe. When the Sun reaches the head at noon, human activities are at height. Likewise, when he is in the Zenith in the horoscope of birth (ie. om the 10th cusp), one is likely to reach enviable heights ## Page 22 18 Saravali in life When the Sun sets, the day ends, breaking the vigour of the day while in the horoscope, the Sun in the setting house (7th house) or in a weak state, reduces the force of other heavenly bodies. That is why Prithuyasas etc. state that the strength of the Sun is very much essential in order that other Yogas become efficacious for the native. We can also see that most authors, e.g. Varaha Mihira, Prithuyasas etc, praised the Sun God in the opening slokas, in their famous astrological works. facarsaft gif: afega gaa areati t aed tft | aerafafater | TG URN uftenatgaaatigaiadt = zardtarq faqafaart east ag” ag aaTa waCaT NAN wa va facateat qaratatieciaaated ea: | aerate wat eet aT RTT ust 2-4, Varaha Mihira in his Hora Sasthra i.e. Brihat Jataka stated briefly the essence of the teachings of the learned sages, viz ten divisions of the zodiac (za ai), Raja Yogas, longevity, effects of planetary periods etc. This could not be done elabo- rately by him and hence I (Kalyana Varma) am conveying in this work such useful essence as culled out from Yavanas etc. rejecting other unuseful portions, which may be appended to the said Brihat Jataka, Notes : The author, Kalyana Varma, has studied Brihat Jataka etc. and gives in this work various principles for the sake of the students of astrology. RaMINGTAT AMAA ASAT SAT atfagafaenfadta agar ate aTeaTaat | sttagerrardeadt vaala engi a areracity Quaeafatratsarrar: seareant Fat nytt 5. I, Kalyana Varma, whose fame, on account of patroni- zing Gods and administering villages and cities, is brilliant like ## Page 23 Chapter 2 19 that of a female swan in the cage of the uaiverse, who is the king of Vyagrapada regioa, present this Saravali, an astrologi- cal treatise, with a chaste heart. areraeuraiai fasargt egracrifafreaat | BEATA AAA ANA arena | TaaT GU 6. Saravali is a river with chilly water which has taken its birth in the mountain called Kalyana Varma, to ward off the thirst for astrology of those interested. Notes : The author is compared to a mountain as he has given birth to the river called Saravali, i.e. the present work, which removes the students’ thirst for Jyotisha. efa wear aifacfaarat areracat arearazarey are Taalsemta: Uti Thus ends the Ist Chapter “Birth of Horasasthra’’ in Kalyana Varma’s Saravali. Huge fregatseaa: [RU Chapter 2 Meaning of Hora facrat fafear aiset aatésercarferet t qamett Teqeaad = aherfrteraaqaT en areata §==— fagueaaterarq aenfrasrart aeaTrarfaraa FEAT UR aimated ag: | data Serney AAT AEM ATTEN RN ## Page 24 20 Saravali oraafafa sfag aeate afeg ateta ater waa dafansazata: aeay | ee: wer aati aera: gearerarsata aa arava aeat wtaaarteta | ATeCaaT: WAU 1-S; The Creator, Brahma, has written on the foreheads of all living beings their fates which are deciphered by the as- ttologers through their pure insight. The first and last letters in the word wetzrz (i.e. day and night) are removed and the word “@tzr” is thus born and has come to exist. The zodiac and the planets are therein as sussed (in these pages). Some scholars say Hora Sastra is indicative of effects of one’s Karma i.e. fate. Some call Lagna or half of a Rasias Hora. In ptactice, the science relating to horoscope is called Hora Sasthra. Hora is capable of anyalising the destiny. Barring this Hora Sastra (i.¢. Astrology) there is no device to help one earn money, to help as abost to cross the ocean of unexpected situations and to serve as an advisor in journey. Notes: The purpose of astrology is to assess one’s livelihood, bad and good incidents in life, journey etc. before hand and plan life suitably. Sze Brihat Jataka, Chapter I, Sloka 3, which states that whatever has been acquired by a person through his past deeds —good or bad—now attain fruition. See what a1%z (Narada) States : AMAA FUT Faadiwaiag, meaning that with- out the kn.wledge of birth time, i.e. sans a horoscope, it is akin to describing an incision in wood or a book. These show the importance of Hora Sastra or the Science of Astrology. afa seargadfacfamat areaeat gaaserdfarar arr fadraseara: RN Thus ends the 2nd Chapter “Meaning of Hora” in Kalyana Varma’s Saravali, ## Page 25 Chapter 3 21 wey uiqagisaa: uz

TAAAR TAATA YAN aalsweaqs sfeat amar ATG: SRTTA FART UN eaqeaTeanea aedtdaraseraraqay | arameafiea: 0 Bra: SEGATAAT URN 1-2. At the time of Pralaya ("4, i.e. Destruction), the Universe plunged into darkness and was. flooded with water, when, all of a sudden, the Sun God, with his brilliant rays appeared in the Universe. He created all the planets and the 12 months. Notes: Each solar month is the result of the Sun’s movement in a particular Rasi and 12 solar months are caused during his sojourn in the 12 Rasis of the zodiac. Ragafaganactag: wat gaa afar: | wal wat: grit dtafeaft | ufsaratit nan wea geal acisa fagd atamaryact at aagi agra seg: cearege gat cared ast: salaatgat wat a atdfeaat Rat ure: eaarqaeat we garaqang ws DESCRIPTION OF THE 12 RASIS 3-4. The names of the 12 Rasis are : Aries, Taurus, Gemini, Cancer, Leo, Virgo, Libra, Scorpio, Sagittarius, Capri- corn, Aquarius and Piscss. The sign Aquarius resembles a man holding a pot while Gemini is compared to a couple holding Veena (qT) and mace (721). A pair of fish is the imagi- ## Page 26 2 Saravali nation about Pisces. Sagittarius is compared to a man, having a hip like that of a horse and holding an arch in his hands. Deer- faced sign is Capricorn, Virgo resembles a virgin sitting ina boat with a lamp in her hands. A male holding Seales in hand represents Libra. The other signs are identical with theirnames. aiteterargeed sot afeahetedtegry a aR aeall wreearsris crassa: WAU BUAATEATAAAT FEAT HET | aeaguedaing «= gery Atazaizarfit nen 5-6. THE LIMBS OF KALA PURUSHA AND THEIR USE : The signs Aries etc. represent the limbs of Kalapurusha as under : Aries: head; Taurus: face; Gemini : arms; Cancer: heart; Leo: stomach; Virgo: hip; Libra: space below navel and private parts; Scorpio : private parts; Sagittarius ; thighs; Capricorn : knees; Aquarius : ankles; Pisces: feet. If at birth, one has benefic planet in a particular sign, the particular limb will be strong. A malefic makes such a limb weak. Notes : While for Kalapurusha, the respective limbs are identified from Aries onwards, for an individual, apart from considering the Rasis as above, one should count from the natal lagna also. For example, suppose one is born in Leo. This sign indicates his head. Hence, when assessing the head of a Leo native, look at Leo and Aries as well, Rerdat Perergeggraeitetaaatan: 1 ASAE’ THallrntarenacgaraeAy: Wott “»« 7. SYNONYMS OF RASIS : Kriya, Tavuru, Jutuma, Kulira, Leya, Pathona, Jook, Kaurpika, Tauksha, Akokera, Hridaya Roga, and Anthya are the other names given respecti- vely to Rasis from Aries onwards. Notes: Such other synonyms can be found in Brihat Jataka, Hora Sara, Hora Ratna, Phala Deepika etc. ## Page 27 Chapter 3 23, weet HaaaTatfa tis: Aa WA at y aeatfa gag fregeariafarted ictt 8. SYNONYMS FOR HOUSES : Riksha (get), Rasi, Kshetra, Bha (4) and Bhavana are identical names given to a house by the sages. aaa aa wameted fagat <faata: 1 maenig strata await cares aecararg nen arated feat: quedsfeaara arefaat: 1 afar yaa: dteat: ahrragar: THT Ugott 9-10. ZODIACAL HALVES, THEIR LORDS, AND EFFECTS : The Rasi chakra with 12 Rasis is called Bhagana (aq). Six sigas counted from Leo to Capricorn consist of Solar Half and the Sun rules this qo wm (Half Zodiac). « Six signs in the reverse order from Cancer to Aquarius is Lunar Half and ruled by the Moon. Barring Cancer and Leo, planets from Mars to Saturn get one Rasi each in each Half, as above. If at birth more planets occupy the Solar Half, the native is brilliant, and if more planets are in Lunar Half, he is soft, good and lucky. Notes : If a majority of planets are placed from Leo to “Capricorn, the native acquires the qualities of the Sun. Should a majority be disposed from Aquarius to Cancer (via'Pisces), the native begets Moon’s disposition, The former makes one splendorous and valorous while the latter makes one soft- spoken and fortunate. aoryygiegefaatrgahraafreriaaniastar: qe AAMTTATTABAYASASTIET UU 11. THE RULERS OF RASIS AND NAVAMASAS : Mars, Venus, Mercury, Moon, Sun, Mercury, Venus, Mars, Jupiter, Saturn, Saturn and Jupiter are the lords respectivelysof Aries to Pisces. The Navamsas for these Rasis are calculated from Aries, Capricorn, Libra and Cancer in their order. ## Page 28 24 Saravali Notes : How to calculate the Navamsa positions is explained below = Each Rasi has nine Navamsas of 3°-20' each, The coun- ting for Aries, Leo and Sagittarius is done from Aries itself. It is done from Capricorn for the signs Taurus, Virgo and Capricorn. For Gemini, Libra and Aquarius, the counting is commenced from Libra. The Navamsas of Cancer, Scorpio and Pisces range from Cancer. Another method is to count from stellar quarters. Take the first 3 stars or 12 quarters and count from Aries and con- clude with Pisces. Proceed in the same manner for each group of 3 stars again and again. That is, Aswini-Bharani-Krittika form one group the Navamsas of which range from Aries to Pisces. Then again proceed in the same way for Rohini-Mrigasira-Aridra group and for other groups. wartiad: aned sraafafed fafarateafaarq i ofafan a wad cant mea AereTet ez 12, SUB-DIVISIONS ESSENTIAL: The effects of a horoscope should be predicted according to the divisions of houses. Without knowing the strength of such lords, one cannot lay even a step forward in the direction of astrology. aiter — aatareaarferearameatreg | gat HageaHT SAT ATT: KATATE: URN 13. VARGOTHAMAMSA : The first Navamsa of a Movable Rasi, the Sth one in a Fixed Rasi and the th one in a Common Rasi (dual sign) are called Vargothamamsas. Should the natal Lagna be in such Vargothama Navamsa, the native becomes an important person in his circle. The rulers of Dwadasamsas start from that Rasi itself. ## Page 29 Chapter 3 25 Notes : The following are 12 Vargothama Navamsas : Aswini I quarter (Aries) Rohini I quarter : (Taurus) Punarvasu III quarter (Gemini) Punarvasu IV quarter : (Cancer) Pubba I quarter (Leo) Chitta I quarter : (Virgo) Chitta IL quarter : (Libra) Anuradha IV quarter: (Scorpio) Uttarashadha I quarter: (Sagittarius) Uttarashadha =-‘I quarter : (Capricorn) Sathabisha MIT quarter : (Aquarius) Revati IV quarter : (Pisces) Dwadasamsas: Each Rasi is divided into 12 Dwada- ‘samsas of 2° 30’ each. The first one falls in that Rasi itself, the second one in the second from there, the third one in the third from there and so on and so forth. These are tabulated on page No. 26. eaeigaaaaam Femara BATES ATATT | vfaaarfaegeat farmers TAMATT Ug 14. LORDS OF DECANATES AND HORAS : The lords of decanates are: First decanate—lord of the same Rasi, second decanate—lord of the Sth Rasi therefrom and third decanate— lord of the 9th from the Rasi in question. The first Hora of an odd Rasi belongs to the Sun while the second one is ruled by the Moon. In the case of an even Rasi, the first Hora is ruled by the Moon and the second Hora by the Sun. Notes: Decanates: Each Rasi is made in three equal parts of 10° each. The three are respectively lorded by the Ast, 5th and 9th lords therefrom. See table on page No. 27. ## Page 30 ‘enby ‘deg ‘Weg “Joog « BIQHT (OBA, HOUR TIMED SMINB] sey _$205td wr Yudeg ug -yoog QT «OBNA =P | snaney, “gouly.‘saasa toby IT ‘x60 Selgy]’ 08mg ~ oo] BeoukD yume snaney, Roi senby: “deg. « WOL “QT -MA 08 r0urD mUIH® suNvy “soy soosiq “tnby. udeg us WE NA tov] ys0UkD .1WIMEH snMBL, soy seosid “enby “deg Weg o1dioog WIS OFT WOUND IMIWEH sninvy, soy soos sndeg «Beg = Joog, BQ HL os] ss0ueD JNIWeD snr] soy . seosiq “enby “Beg Joos QIT(OBNA ND JoouRD WME sniney soy soosig ‘enby ‘WdeD *100§ IA oot HS TWWED snmvy soy scosig ‘enby ‘ude “Beg ‘JOS qT “HA OPT JeourD MP snmeL sony sosig ‘enby ‘nde ‘Weg “s0og wIqYT O83A oo] isomer WIMEH PIE sony soosig ‘enby ‘deg ‘Beg Joog emg] «OBA OO NOUR TUIMEH smINeL PUz soosid ‘enby ‘Wdeg Ieg “100g BIGHT «OBA «= OBTT._—«aoURD JuIMOH snmB_ sey ST 09 smtuv}} Le saosig snjonby -udey Hing erducng miqry OPA. 087] sao’ IaH snanny salsy -SOPDA VSWvSVadVAG* 4o d18viv ## Page 31 21 Chapier 3 siv\—‘I0og WwOOW—J20uR_ sondn¢—soostq ‘s008Td Ssausg—vqry | Aandes-ttD +f) Hames —enby enby® Aandioy—o8314 tated gunk, uinyug—udeg pdt - ung—097 srew—sony sndng—"Beg ees woop ieout | soydng—-soosig sIL— 00g 109§ Asnosapy—ru1w196 uinyeg —"enby, snuo,—exqry eget snuoaq—sninvy, winjeg—uwsoorideD, © kanorsyy—o8st A, O81, sueW—sony sondng—1B0g ung—o9y oot sondng—soosig sre py—ordsoog vooW—s200% sooueg wingeg—snuenby snusA—PiqrT AinolaW—lulmap Torae5 uineg—ideg Aino1ay—O83 A, snua,—sniney, sniney soydn¢— "stg, ung—09] sivw—sony sony © 02 °F 1.01 0 sui psy AE OF {1.07 SQUOT UIAHL F SALYNVOAC AO aTaVvL ## Page 32 28 Saravali Suppose a planet is in 12° of Pisces, which means it is in the second decanate. The second decanate of Pisces falls in Cancer and the ruler thereof is the Moon. HORAS : Each Rasi is divided in two equal parts of 15°. The first Hora of an odd Rasi is ruled by the Sun and the second by Moon. In the case of even Rasis, the first and second Horas are respectively ruled by the Moon and the Sun. See the Table below : TABLE OF LORDS OF HORAS Rasi 1° to 15° 15° 1’ to 30° Aries Sun Moon Taurus Moon Sun Gemini Sun Moon Cancer Moon Sun Leo Sun Moon Virgo Moon Sun Libra Sun Moon Scorpio Moon Sun Sagittarius Sun Moon Capricorn Moon Sun Aquarurs Sun Moon Pisces Moon Sun Assume a planet is in 17° of Virgo, which is an even Rasi. It is in the second Hora ruled by the Sua. aeaggifaarniernianeg arg | RETA: Hartetaagarary Usui 15. LORDS OF TRIMSAMSAS : In odd signs, 5, 5, 8,7 and 5 degrees are Trimsamsas of Mars, Saturn, Jupiter, Mercury and Venus respectively while the arrangement is reverse in even signs. Notes: The Sun and the Moon have no lordship over Trimsamsa division. Now see the table as under : ## Page 33 Chapter 3 2» TABLE OF TRIMSAMSAS Odd Signs Even Signs up to 5° Mars up to 5° Venus S* I’ to 10° Saturn ul ghz Mercury 10° 1’ to 18’ Jupiter 12° 1’to 20° Jupiter 18° 1’ to 25° Mercury 20° 1’ to 25° Saturo 25° 1’ to 30° Venus 25° 1’ to 30° Mars Suppose a planet is at 28° of an odd sign, then it falls Venusian Trimsamsa, If it is in 8° of an even siga, then the Trimsamsa belongs to Mercury. In the context of Female Horoscopy, these positions are very useful. See chapter 46 for details. Anfafaaqnefetagararrartercaat | wercmeargat: aaiarat || Waele: neg 16. LORDS OF SAPTAMSNS : The Saptamsas for the 12 Rasis from Aries onwards are respectively counted from Aries, Scorpio, Gemini, Capricorn, Leo, Pisces, Libra, Taurus, Sagittarius, Cancer, Aquarius and Virgo. The lords thereof are those in whose Rasis they fall. Notes; The idea is that the counting of Saptamsa for odd'signs starts from that sign itself. In the case of even Rasis, it is from the opposite house. For example, the counting of 1/7th Amsa starts from Leo itself for Leo, the second is Virgo, third is Libra and soon and so forth. For Cancer, an even Rasi, the counting is done from Capricorn, Each Rasi is made in seven equal parts to be called as Saptamsa. Each Saptamsa thus equals to 4°17' 84”. Till now in the previous pages, we have had the following divisions : 1. Rasi_ 2. Hora 3, Drekkana 4. Navamsa 5. Dwa- dasamsa 6. Trimsamsa 7. Saptamamsa. There are other niné esseatial divisions to complete the Shodasa Varga (16 Varga) scheme. Some are satisfied with 10 Vargas and yet ## Page 34 30 some with 7 Vargas, For the information of the readers, the lacuna is completed as under : (8). Turvamsa : Each sign is made in four equal parts of T° 30’ cach. The first Turyamsa is lorded by the lord of the same Rasi, the second one by the lord of the 4th sign, the third one by the lord of the 7th sign and the 4th one by the lord of 10th sign, For example, the lords of 4 Tuyramsas in Aries are respectively : i Mars (Aries), Moon (Cancer), Venus (Libra) and Saturn (Capricorn). Similarly, for other positions in various Rasis these may be noted. . (9) Dasamsa : Each Rasi is divided in 10 parts of 3° each. In odd signs, the counting is from the sign itself. For even signs, the counting is from the ninth thereof, For example, the Ist Dasamsa of Aries, is in Aries itself, the 2nd in Taurus, the 3rd in Gemini and so on and so forth, Take Scorpio an eyen Rasi. Its first Dasamsa falls in Cancer which is the 9th Rasi from Scorpio. The second falls in Leo, the third in Virgo, the fourth in Libra and so on and so forth. ’ (10) Shodasamsa (i.e. 1/16th of a Rasi): This, is also called Khalaamsa. Each Rasi is made in 16 equal parts i,e,, 1g degrees. The counting commences from Aries for Chara Rasis, from Leo for Sthira Rasis and from Sagittarius for’ Dwi- swabhava Rasis. To give an example, in the case of movable signs, the first Shodasamsa is Aries, the 2ndis Taurus, and so on; the 13th is again Aries, the 14th is again Taurus the 15th is again Gemini and the last one, 16th is again Cancer. Similar calculations should be made for fixed and dual (common) signs accordingly. (11) Viowsamsa : Bach Basi is tnade in 20 equal partveach of 1°30’. The counting for movable signs commences from Aries, for dual signs from Sagittarius and for common sign’ from Leo: For example take a common sign, for which counting is to'be done from Leo. The first, Vimsamsa-is. dn theo, the second in Virgo, the 12th in Cancer, the 13th in Keo again arid soon and so forth, with the 20th Vimsamsa ## Page 35 Chapter 3 31 ending in Pisces. Similarly, for other signs, suitable deductions can be made. (12) .Chaturvimsamsa: Each Rasi is made in 24 equal parts. This is also called Siddhamsa. One such division is made up of 1° 15’ of arc. For odd signs, the 24 divisions are counted from Leo while for even signs the counting is from Cancer. For example, the first Siddhamsa of Aries is Leo, the 2nd is Virgo, the 3rd is Libra, the 13th is again Leo, the 14th is Virgo while the 24th one is Cancer. In the case of Taurus, an even sign, the Ist one is Cancer, the 2nd one is Leo, the 3rd one is Virgo, the 12th one is Gemini, the 13th is again Cancer, the 14th is again Leo while the 24th is again Gemini. The intermediary ones may be suitably understood accordingly. ; (13) Nakshatramsa or Sapthavimsamsa: This is 1/27th part of a Rasi. The counting starts from the Rasi itself, whether it is an odd one or an even one. For example, for Aries, start from Aries and count upto Pisces, you get 12 Sapthavimsamsas. Then the 13th one is again Aries, the 14th is Taurus, the 24th is Pisces, the 25th is again Aries, the 26th one is Taurus and the 27th one is Gemini. (14) Swa-Vedamsa : Bach Rasi is made in 40 equal parts, each of 45’ of arc. The counting for odd signs commences from Aries while Libra is the starting point for even signs. For example, for odd Rasis, we complete 3 rounds from Aries to Pisces to get 36 Swavedamsas. The 37th one is again Aries, the 38th one is Taurus, the 39th one is Gemini and the 40th one is Cancer.. Similarly for even Rasis, starting from Libra, we complete 3 rounds upto Virgo to get 36 Swavedamsas. The 37th, 38th, 39th, and the 40th ones are respectively Libra, Scorpio, Sagittarius and Capricorn. (15) Akshavedamsas : Each Rasi is divided into 45 equal parts, each of 40’ of arc. In the case of movable Rasis, the rulership is counted from Aries; from Leo in so far as fixed Rasis are concerned and from Sagittarius for dual signs, ## Page 36 32 each Rasi has 60 such Shashtiamsas. Saravali (16) Shashtiamsas : 30’ of arc makes one Shashtiamsa and In the case of an odd sign, the designations of Shashtiamsas are as under. The suffix “M” indicates that it isa malefic Shashtiamsa while “B” tells you that it is benefic. 35. 37. 39, 41. 43. 45. 47, 49, 51. 53. 55. mm 59. Ghora—M Deva—B ‘Yaksha—B Bhrashtamsa—M Garalamsa—M Maya—M Apampatya—B Kaala -M Amrita—B Mrudu—B Horambha—B Vishnu—B Dewa —-B Kalinamsa—M Kamalakara—B Mruthyu—M Dawagni—M Yama—M Sudha—B Poornachandra—B. Kalinamsa—M Utpata—M Soumya—B Seethala—B Indumukha—M Kalagni—B Nirmala—B Kroora—M Sudha—B Bramana—M Rakshasa—M. Kubera—B Kinnera—B Kulagnamsa—M. Agani—M Pretapureesa—M Marutwa—B Abibhaga—B Chandra—B Komala—B Brahma—B Maheswara—B Ardra—B Kshitiswara—B Gulikamsa—M Kaala—M Horamsa—M Kantaka—M Amrita~B Vishpratganda—M Vamsakhaya—B Kaliroopa—M. Komala—B Dhanshtrakarala—B Pravina—M Dandayuda —M Soumya—B Atiseetala—B Payodeesa—B Indurekha—B For even signs, the counting is reverse. That is the 60th ## Page 37 Chapter 3 33 one of odd Rasi will be the first one of even Rasi. The second ‘one of an even Rasi is the same as the 59th one of an odd Rasi, and so on and so forth. Saptavargas : These consist of Rasi, Hora, Decanat e, Sapthamsa, Navamsa, Dvadasamsa and Trimsamsa. Dasa Vargas: Khalamsa, Dasamsa and Shashtiamsa calculations are added to the above-mentioned Sapthavarga scheme, to get Dasavargas. Shodasa Vargas : These are sixteen divisions, which Ihave explained in the previous pages. The use of the said 16 vargas is explained below : (1) Rasi Lagna Appearance, shape, etc, (2) Hora Financial status (3) Decanate Brothers and happiness from them (4) Turyamsa Bhagya or prosperity (5) Sapthamsa Children and grand children (6) Navamsa Wife (7) Dasamsa Profession (8) Dvadasamsa Father and mother (9) Khalamsa Conveyances (10) Vimsamsa Success (11) Chaturvimsamsa Education (12) Nakshatramsa Strength (13) Trimsamsa Malefic results (14) Swavedamsa Good and,.bad (15} Akshavedamsa Good and bad (16) Shashtiamsa Good and bad afggtcr sda: atgrar ar feacafaatar fecarragranaatts oftadat: Fang ugen 17. The total of the number of Horas and that of deca- nates is sixty (24-+36), inthe entire Zodiac. The figure is increased by 72 if the total of Horas-+Navamsas is required, ie. 60+72=24+108=132. Each Rasi has 1800 Kalas (30 degrees each of 60’ of arc). ## Page 38 34 Saravali arardtat frat Ram: eagrfeartag frat: 1 agreratawaat tea: eardtftad) at: ues 18. DIFFERENT VARGAS : To know any kind of Varga (ie. Hora, Navamsa, Drekkana etc.) adopt the following method : convert the longitude into minutes of arc and multi- ply by the Varga figure concerned. Divide the product by 1800. The resultant figure will reveal the required Varga. Notes : Suppose a planet is in 15° of Aries and we want to know the Navamsa position. 15° converted into:minutes becomes 900 This should be multiplied by 9 which is the figure for Navamsa, We get 8100. Divided by 1800, this yields 4 completed Navamsas with a remainder which indicates the Sth Navamsa. The factor of multiplication for Hora is 2, for decanate 3, for Dasamsa 10 and so on and so forth. These Vargas can be found from the tables already given earlier without undergoing this ordalium. wast quater faeacat agora aet 1 aft: eapat | aeremertttery | aA zeit 19, The malefic and benefic effects of such Vargas are explained in detail in the Nashta Jataka chapters (at the end). morfea: HeQA quiet ae: feadt frsagea epr: | giemtaforeraate aaa meratate sfesquron ara a stafa att argeal waxagagar afe stafe aere agnaget wagga: uaen 20-21. RASIS—BENEFIC AND MALEFIC IN NATURE; GANDANTA AND ITS EFFECTS : From Aries onwards, alter- natively the Rasis are known as malefic and benefic on the one hand, and male and female on the other band. These are also classified as chara (Movable), Sthira (Fixed or Immovable) and Dyiswabhava (Ubhaya, dual or common) Rasis. The ending portions of Cancer, Scorpio and Pisces are called Gandanta. It is said that one born in Gandanta will not survive. He will either lose his mother or he will end the dynasty, i.e. he is the last of his descent and will not have any children, Jf, ## Page 39 Chapter 3 35 however, he survives, he becomes a king with many elephants and horses. Notes : The Rasis are classified as under : Aries odd male Taurus even female Gemini odd male Cancer even female Leo . odd male Virgo even female Libra odd male Scorpio even female Sagittarius odd male Capricorn even female Aquarius odd male Pisces even female Gandanta : For Gandanta, I have given elaborate notes in my translation of Horasara, vide chapter 5 which the reader may consult, terarfeg ofcad fered fad fafireg Aare: 1 fate faagatarfz fawertteeray nee 22, DIRECTIONS OF RASIS : The four Rasis from Aries onwards indicate East, South, West and North, while the remaining Rasis repeat in the same way. A journey under- taken by a person towards the direction indicated by the Lagna or the Moon (at the commencement of journey) yields fruitful results. Notes: According to the above rule, for example, if “Aries is the Lagna at the commencement ofa journey, or if the Moon be in Aries, there is success in the eastern direction, Now, the directions indicated in this Sloka are : Aries, Leo and Sagittarius East Taurus, Virgo and Capricorn South Gemini, Libra and Aquarius West Cancer, Scorpio and Pisces North ## Page 40 36 Saravali According to Prasna Marga (chapter 2), the directions are divided among the zodiacal signs as under : Aries—Taurus : East Cancer—Leo : South Libra—Scorpio : | West Aquarius—Capricorn North Gemini : South-East Virgo South-West Sagittarius North-West Pisces North-East Planetary rulerships are denoted in sloka 8 of chapter 4 infra. arrgakanaas sare srfenrfer afer: | fafa faa aeeqrai cara: geal aarferafrar: ugg 23. DIGBALA AND KALABALA : Human signs, quad- ruped signs, Scorpio and watery signs are respectively strong in the directions commencing from the east. Further during night time quardruped signs, day time human or biped signs and the second half of Capricorn, Scorpio, Cancer and Pisces are strong at the time of day break and or night fall . Notes : Digbala of signs: Each Rasi assumes strength when it happens to be a certain Bhava. East represents Lagna, South represents the 10th house, West represents the 7th house (ie. the opposite of Lagna) while the 4th house (i.e. opposite of the 10th, the South) is the North. The northern point is also called Nadir; the Western point is known as descendant and the southern point is the zenith of the horoscope. The ascendant and the planets (from the Sun to Saturn) in their usual motion move from East to West via the North. That is their motion is anticlockwise. Rahu, Ketu and others (i.e. Mars to Saturn) when retrograde move from West to East via North i,c. clockwise, ## Page 41 Chapter 3 37 Human signs are: Gemini, Virgo, Libra, Aquarius and first half of Sagittarius. Quadruped signs are: Aries, Taurus, Leo, second half of Sagittarius and first half of Capricorn. Watery signs are : Cancer, Scorpio, Pisces and second half of Capricorn. Keeta Rasi or insect sign in Scorpio as per Garga and Mantreswara. But’ Parasara includes Cancer also. Horasara classifies the 3 watery signs as Keeta Rasi with particular emphasis on Scorpio. Now, the first part of the sloka can be well-conceived. Human signs are strong in the east or ascendant. Biped signs are strong in south or the 10th. Scorpio is strong in the West or the 7th while watery signs (excluding Scorpio) have strength in the north or the 4th. Similar view is found in Horasara of Prithuyasas (ch. I, s.12) and Jataka Parijatha (ch. I, S. 16-18). The Kalabala of Rasis are clear, as given in the text. aria faqaateqarstear aaa afegarfiacraaar: | qsataar: afaqat faad fagra Fer: fattfreeaaquas aa: uw 24. DAY AND NIGHT SIGNS—SIRSHODAYA AND PRISHTODAYA SIGNS: Gemini, Cancer, Capricorn Aries, Taurus and Sagittarius are nignt signs. Leo, Libra, Scorpio, Aquarius, Pisces and Virgo are day signs. The signs Cancer, Capricorn, Aries, Sagittarius and Taurus are called Prishtodaya which rise with hind part. Sirodaya sigas (rising with head) are: Leo, Libra, Scorpio, Virgo, Aquarius and Gemini. The sign Pisces is Ubhayodaya (i.e. that rises with both head and hind part). ## Page 42 38 Saravali Notes: The use of day signs and night signs is mani- fold in lost horoscopy. For details see my English translation of NASHTA JATAKA. aretuaraeg: agaetia afendatfry afrgastarearats uftdaatet Fess: URL 25. STRENGTH OF RAST: If a Rasi is aspected by its lord, or by a planet that is friendly to its lord or by Mercury or by Jupiter, it is said to be strong. Planets other than the above do not lend strength by aspect. awadagaaraagaredtiaarageatia | wRiaemaaal aaTET wraafearaaT: uREN afmeriteaqentrnramaratg faerie | gearaacaiate afaararefn atari uzou 26-27. SYNONYMS OF 12 BHAVAS. Lagna Thanu and Sakthi Second Artha and Dhana Third Sahaja and Parakrama Fourth Bandhava and Griha Fifth Putra and Pratibha Sixth Ari and Vrana Seventh Stri and Kama Eighth Vinasa and Dehavivara Ninth Punya and Guru ‘Tenth Karma and Mana (ara) Eleventh Aya and Bhaya (714) Twelfth Vyaya Notes : The ascendant denotes the physique and vigour of the native, The second house is indicative of money while co-born and valour are to be noted from the 3rd. Residences and relatives are governed by the 4th. The children and intelligence are reflected by the Sth, Enemies and wounds come under the 6th. Sexual acts and spouse fall under the 7th, The 8th house holds death. One’s past merits, preceptors ## Page 43 Chapter 3 39 and elders should be estimated from the 9th. Profession (work) and honour are related to the 10th. Income and prosperity are to be noted from the 11th while the last house highlights expenses. For more detailed information, see pp 183-187 of Horasara. ast aragaatageat 4 aaa aan Serer ages wee BRT RSH amit agéea g ganataraaaiggarta 1 asatarageaaey aaa TAA UREN adgaalfeaste gaea ifeafaaltarfafa aca: aa omrreaag aif | wearaemteat: Rett gaate fequad qdtana stdafa ghraaq fea ograwad fedtadae 9 gerd a gen 28-31 ADDITIONAL SYNONYMS. The 4th (Vesma) and the 8th are called as Chaturasra houses, The 9th is known as Tapa (az) i.e. penance. The 4th hias names like Sukha (happiness), Jala (water), Patala (nether- world). Bandhu (relatives) and Hibuka. The other names given to the 10th house are : Karma (deed), Agna (command), Gagana (sky or zenith) and Meshurana. The Sth and 9th are trines. The Sth is the only house connected with Dhi (ie intellect) while the 9th house is Tritrikona, ic, the trine of trine. The 7thh ouse is called Dyuna, Astha (setting), Jaayg(ara1) and Jamitra. The 6th is Shatkona; the 3rd is Duschikya and the 12th Rippha, Kutumba is the 2nd house. Notes : The word Jamitram (afta) is derived from wat and is indicative of the future goodluck of one’s wife. The word is obviously connected with the Greek word diametron, Regarding trines, only the Sth and the 9th are strictly trines while the ascendant is not included in this classification. ## Page 44 40 Saravali Our author uses the words “‘qafaatar” to indicate the first, Sth and 9th houses separately in sloka 30 of this Chapter. Such separate mention for the ascendant can be noticed while the 5th and 9th are discussed, in Horasara and others. Also refer to Jataka Parijata (Ch.1), Jataka Tatwa (1-27), Lagna Chandrika (1-6), Brihat Jataka (Ch. 1), Phal Deepika (1-17/18) and my English translations of Brihat Parsara Hora (Ch. 8, sloka 35) and Horasara (Ch. 1, sloka 33). Thus, we may know that the ascendant is not designated as a trine in any standard astral literature. Rares: TUNA aah: TT 1 aragarafaea | FAT HAT aaa RR 32. KENDRA, APOKLIMA AND PANAPHARA- EFFECTS-THEREOF : The adjoining houses with reference to angles (Kendras) are Panaphara. The houses next to Panapharas are Apoklima houses. The planets in angles give effects in one’s boyhood. The effects of planets in Panapharas are felt in the middle age while the planets in Apoklima give result at the conclusion of the natives’s life, Notes : Kendras are Ist, 4th, 7th and 10th houses. Pana- pharas (also called cadent houses) are the 2nd, Sth, 8th and 11th, Apoklima houses (succedent) are the 3rd, 6th, 9th and 12th houses. The good or bad effects ate specially revealed in the boyhood, youth and old age according to their placement in angles, cadents or succedents. weaawagararegraad ait ateaa waaggagaredateageaae frarha area uaa 33 UPACHAYA AND ANUPACHAYA : The 6th, 10th, 1th and 3rd are called upachaya houses while the Ist, 2nd, 4th, Sth, 7th, 8th, 9th and 12th are Anupachaya houses, Notes : The word sqqaq is derived thus : 44-347 ## Page 45 Chapter 3 41 fagqatamqrartaretiagraaet: qaidara faatgeaait seat uae 34. MOOLATRIKONAS OF PLANETS: Leo, Taurus, Aries, Virgo, Sagittarius, Libra and Aquarius are the respective Moolatrikonas for the planets from the Sun onwards. Notes : For more details, see Horasara, page 20. qaidrgear: fragegrgafeatartagan: | eayenfaaart aarti TTHTEAT: NRK feagapianiafatiarafaaatara: 1 eatearacanefta: «| EQTSHTCUTAT NRE 35-36. EXALTATION AND FALL : Aries, Taurus, Capri- corn, Virgo, Cancer, Pisces and Libra respectively are the signs of exaltation for the Sun, Moon, Mars, Mercury, Jupiter, Venus and Saturn. These are deeply exalted at 10, 3, 28, 15, 5, 27 and 20 degrees in the respective Rasis. The Rasis opposite exaltation are the places of debilitation for the planets concerned, And the respective degrees are of deep fall. Notes : Planets derive strength by virtue of exaltation and are weak if in fall. Even if a planet is in exaltation in Rasi but in itsfallen Navamsa, its effects are neutralized. Conversely though it may be in its debilitation Rasi, but in exaltation Navamsa, its good effects only increase. Now, sce the table of exaltation and fall for various planets : Planet Deep exaltation Deep fall degree degree Sun Aries 10° Libra 10° Moon Taurus 3° Scorpio 3° Mars Capricorn 28° Cancer 28° Mercury Virgo 15° Pisces i Jupiter Cancer 5° Capricom 5° Venus Pisces 27° Virgo 27° Saturn Libra 20° Aries 20° ## Page 46 42 Saravali The nodes are differently discussed in this context. Various schools have allotted differing Rasis as exaltation and debilitation zones for Rahu and Ketu, Without bothering one- self at this stage about the controversy, one can gather consoli- dated information from my notes given on pages 20-21 of Horasara. eekatirtisee fraagafegrgarat at: 1 ghannargrafatest «atat: | aareqten: not ufactatfera: «= aitdsrqettft | aretterfr aga «fase oo gamaratea geatft nach 37-38. LONG, MEDIUM AND SHORT ASCENSIONS OF SIGNS : Pisces, Taurus, Aries and Aquarius are signs of short ascension. Gemini, Sagittarius, Cancer, and Capricorn are of medium ascension. The long ascension signs are : Scorpio, Virgo, Leo and Libra. The head and other organs of the native will be similar to the sign ascending at birth and other relative signs. The planets occupying such houses will also influence the form and shape of the various organs. } Notes : If, for example, Scorpio ascends at birth, the head of the native will be long. Should Aries rise, the head is small. The influence lent by planets will also have a say on this matter. For significations of organs, see next chapter. In Jataka Parijatha, Ch. I, Pisces is stated to be of medium ascension. Also see Horasara, Ch. I, sloka 24, waerfaafeara cae ef aad: saena: faa: 1 aeaam fafagarafate oagtefe: = TAT UREN 39, FAVOURABLE DIRECTIONS FOR JOURNEYS: The direction ruled by the lord of a Rasi_ bscomes Plava direc- tion for that Rasi. This is Yavana’s school of thought. If the king undertakes his journey towards such direction indicated by the Rasi concerned, he attains quick sucoess. ## Page 47 Chapter 3 43 Notes : The directions ruled by the planets are indicated in sloka 8, Ch. 4, infra, From the same, we can see, for example, Saturn rules west. If one proceeds to the west when Capricora or Aquarius rises (orthe Moon being so posited) he will attain victory effortlessly. . atigafaagegica: oreacieysargfaarea | were: sive carfeaat: ey: wen waleayerat oaafeva: = gfeat feta ata oamena aafrreafadta « 2afega een 40-41. COLOURS OF RASIS: From Aries onwards the following 12 colours are allotted to the various Rasis respecti- vely : red, white, green, pink, brown, grey, variegated, black, golden, yellow, deep brown and white. If an idol of ‘the lord of the ascendant is made in the colour alloted (as above) and is worshipped, the native will destroy his enemies just as Lord Indra destroyed the demons. fa searadfacfaarat arcracat ufatel arr qelatsera: w31 Thus ends the 3rd chapter ‘‘Rasi Description’ of Kalayana Varma’s Saravali. BA AUIS: ust

arent via: saweeg Fa: aed aera: afasitsa ara gefadt arage aera cg: aft: ere Fz UI areredt aatifafidearat: 1 gaaddara g fare wa: we URN 1-2, KALAPURUSHA’S SOUL ETC. AND THEIR USE : The Sun is the soul of the zodiac personified, the Moon ## Page 48 44 Saravali mind, Mars strength, Mercury speech (voice), Jupiter intelli- gence, Venus comforts, Rabu ego and Saturn grief. If at birth, planets indicative of soul etc. (as above) are strong, these significations will equally be strong. If these planets are weak, the effects are only meagre. But in the case of Saturn it is different. BATA THTIAATT AARTA Alelamewarary | Tara sora aaa: ATT WAATAT: TFAT: UAW ved cent ag aTHAAATATT | aeqatfzaceea Agr aaa AAT eu qaictaamimaagd wet gqrard Wareergsi J wsdgertterfa ara: ga: 1 afafagyt a gongre atest argat We Tag Aaravasiies Far FATA wwe art avi aTSaAAG ateat: eat cacraagar feaaea 1 gaha wealfaatg fagied aereafeadtadear: neu 3-6. The counting of limbs according to the decanate rising at birth should be identified as under : If the first dezanate rises, count from head; if the second decanate rises from neck and if the 3rd one rises, count from pelvis. The 6 Rasis backwards from the ascendant denote the left side of the body while the 6 forward Rasis from Lagna indicate the right side of the body. Should the first decanate of a sign ascend the lapsed part of the ascendant denotes left side of the head and the part to rise yet indicates the right side of the head, the 2nd and 12th denote right and left eyes respecti- vely; the 3rd and 11th right and left ears; the 4th and 10th right and left nose; the Sth and 9th right and left cheeks; the 6th and 8th right and left chins and the 7th left side of the face (by area yet to rise) and the 7th right side of the face (by portion already descended). If the 2nd decanate rises neck, shoulder, arms, side, heart, stomach, and navel are to be understood in the same order. Should the third decanate rise, pelvis, anus, penis, ## Page 49 Chapter 4 45 testicle, thigh, knee, calf, and feet will be counted in the same order. The decanates occupied by malefics denote wounds etc. while the ones by benefics indicate marks (or moles) on the limbs concerned. Should these planets be in their own Rasi or Amsa at birth, then the wound or mole are right from birth; otherwise these will be caused later on (in appropriate periods). Notes : If the first decanate be rising, the limbs denoted are as under : Lagna — head —_(right/left side) Qnd/12th =— eyes _—_(right/left) 3rd/11th _- ears (right/left) 4th/10th — nose —_(right/left side) Sth/9th - cheeks (right/left) 6th/8th — chins —_(right/left) 1th — face — (right/left) In the case of 2nd decanate ascending, the counting is from neck, as under : Lagna — neck —_(right/Left side) 2nd/12th — shoulder (right/left) 3rd/11th — arm —(rightyleft) 4th/10th — side —_(right/left) sth/9th — heart —_(right/left side) 6th/8th — stomach (right/left side) 7th — navel (right/left side) If the 3rd decanate ascends, then the arrangement takes place from pelvis as under : Lagnn— — _ pelvis (right/left) 2nd/12th = — —anus/penis (right/left) 3rd/llth — testicle (cight/left) 4th/10th = — thigh (right/left) sth/9th — knee (right/left) 6th/8th — calf (cight/left) Tth = fer (right/left) ## Page 50 46 Saravali Ifa decanate is occupied by a malefic, say, Mars, there will be wound etc. on the limb. A benefic denotes mole, Should this be in a Rasi/Amsa owned by it, then the effect is from birth itself. If not, this will occur in its dasa bhukti later on. wrt vf: aa ge FATT: aerate: ferfaga: afaat frasat yereaates tis: aaa aera gafa seuana fata eq wo 7. PLANETARY PORTFOLIOS AND THEIR USE: The Sun and the Moon are said to be the kings. Mercury is the prince, Mars army chief, Jupiter and Venus ministers while Saturn is servant. The native acquires such qualities as of the strongest planet. weg: ae: erage: afgta: afa: att ateaferaraat a srearfafareiterer: usu 8. PLANETARY DIRECTIONS : The Sun, Venus, Mars, Rahu, Saturn, the Moon, Mercury and Jupiter are respectively the lords of the directions commencing from the east. Notes: The planetary rulerships of the 8 quarters are clarified below : 1. The Sun-East 2. Saturn-West 3. Venus-South-east 4. The Moon-North-west 5. Mars-South 6. Mercury-North 7. Rahu-South-west 8. Jupiter-North-cast. The directions are related to the zodiacal signs also vide sloka 22, Ch. 3, supra. qegayar: atea: atfegerat fave: oar: 1 afastsgadgea: ela fare: at: ven 9. PLANETARY NATURE : Jupiter, Mercury and Venus are bencfics in nature. Saturn, Mars and the Sun are natural malefics. Mercury in the company of malefics and the Moon -f decreasing are also considered malefics, ## Page 51 Chapter 4 41 Notes: Thus, Jupiter and Venus are the only natural benefics, Mercury, if not in the company of malefics, remains a natural benefic. Otherwise, if he gets associated with natural malefics, he turns into a malefic. As regards Moon, she is benefic in the bright half and a malefic in dark half. Accord- ing to some, she is good from bright half Dasami to Dark half Panchami (See also sloka 16, Ch. 5, infra). Apart from natural benefics and natural malefics, planets are goodor bad according to the sign rising at birth, For details, see my English translation of Brihat Parasara Hora, (Ch. 34). faatg: weit aa: axen fafraaa) AIR TaaeAAT Tat FAA fag sits aA: ugou geteqrafger stat greafaes frat yy: 1 wee: Bla aa: gout faeraearia awa: gen 10-11. SYNONYMS OF PLANETS : Heli and Bhanu are the other names given to the Sun. The Moon is called Sasi, Krooradrik, Bhomisuta, Aara (rz), Rakta, and Vakra are indicative of Mars. Hemna, Vid, Gna and Bodhana denote Mercury. Eedya (£gq), ljya (gaz), Angira and Jiva all are Jupiter’s names. Aasphujit, Sita (faa) and Bhrigu mean Venus. Manda, Kona, Yama and Krishna are Saturn's synonyms. For these planets, there are various other names which should be elicited from other texts. Notes: There are many other names with which the planets are referred to in traditional astrological literature. The curious reader may consult notes given under sloka 41, Ch. 2 of my English version of Horasara. arafarrenganitatafearieer gardtary i WAR TATE SAAT ATM ATE: FAT UN aelfeagaaenet: IE MATT waaTaaeaay arate aetsfea: atery wean 12-13, PLANETARY COLOURS, DEITIES AND ## Page 52 48 Saravali THEIR USE : From the Sun onwards, the respective hues of the planets are : copper-red, white, (blood) red, green, yellow, variegated, and black. The deities for these planets are re pectively: Fire, Water, Kartikeya, Vishnu, Indra, Sachi Devi and Brahma. The planets from the Sun onwards should be worshipped by the Mantras concerned and if trips to the respective directions are undertaken, one can gain gold, gems, elephants etc. Notes : The colours described can be noted from Brihat Parasara Hora Sastra (Ch. 1), Brihat Jataka (Ch, 11), Horasara (Ch. 2), Jataka Parijatha (Ch. If), Prasna Marga (Ch. 16), Phala Deepika (Ch. 11) etc. The planetary directions are given in sloka 8, of this chapter. If one undertakes a journey to the directions concerned after worshipping a planet, he will stand to gain. For example, one wants go to the northeast; he must worship the -planet Jupiter (and also Indra) before proceeding. Then, he can achieve his aim unhindered. tte wafadt aqancdt ataretsraterit qai ctafarnchattagar, fase gatsiqer: 1 tat qagat feat aaradt fered weal ga: qarait fafagadtanedt wharea: afar: ues 14, SEX, CASTE AND ELEMENTS :The Moon and Venus are females. Mercury and Saturn rule neutrals (i.e. these two are neutrals). Males are Jupiter, the Sun and Mars. Brahmins are ruled by Jupiter and Venus. The Sun and Mars preside over the royal lot. The Moon rules Vaisyas (business community). Saturn rules those of mixed breed while Mercury presides over Sudras, (the 4th caste people). The five primordial compounds, viz. Fire, Barth, Ether, Water and Air are respectively ruled by planets from Mars onwards. agraafia fa faaageremaracafaararry | Teatarfrfagreriaaatigen cat NEN 15, PLANETARY TASTES AND ABODES: The pla- ## Page 53 Chapter 4 49 nets,from the Sun on are attributed tastes as under : acrid, saline, bitter, mixed, sweet, sour (aciduous) and astringent. Their abodes respectively are : temples, water-resorts, fire houses, sports ground, treasury, bed-room and dirty places. Notes: The planets from the Sun to Saturn, leaving Mercury have been allotted individual Rasas or tastes while Mefetty reveals a mixture of al the six tastes. For planetary abodes, also see Sarvartha Chintamani, Ch. I, sloka 80. wearer ey argatahanaganeaesgaATAy | araaiuentabrarcrngaaraat asf ugg 16. PLANETARY ROBES AND SUBSTANCES : From the Sun onwards, the apparels attributed are: coarse, new, burnt,, water-soaked, neither new nor old i.e. recent, durable and arag. Similarly, copper, gem, gold. metal alloy, silver, pearl and iron are in their order denoted by the Sun etc. ending with Saturn, Notes : Rahu is alloted a multi-coloured apparel while Ketu a much torn piece of cloth, see Sarvartha Chintamani, Ch. I, sloka 81. Similarly for Rahu lead and for Ketu sapphire is indicated by Venkatesa Daivagana. moeufcrriarrenaacat | eAaat: 1 fafetarian: afafaadtargguaitar: ueou 17. PERIODS AND RITUS OF PLANETS: Ayana (aaa), Muhurtha, Ahoratra (day and night), Ritu (season), month, fortnight and year are respectively ruled by the planets from the Sun to Saturn. The seasons, viz. Sisira, Vasanta, Grishma, Varsha, Sarat, and Hemanta are respectively ruled by Saturn, Venus, Mars, Moon, Mercury and Jupiter. Notes : Apart from Mars, the Sun also gets rulership of Grishma Ritu. These Ritus can te used in lost horoscopy ## Page 54 50 Saravali also. For details, consult my English translation of Nashta Jataka. ararfaraegea: rat critfcrtarrerarer: | aracdt fegfant mig a adda usu 18. USE OF THESE : In the matter of winning enemies, delivery of child or such questions, materialization of the objective concerned will be as per the period allotted to the Lagna Lord. This should be understood according to the ascendant passed, Notes : Suppose Jupiter is the Lagna Lord ina query relating to child birth, with the Prasna Lagna having passed 10 degrees. Jupiter indicates the period month as per the previous sloka and hence one third of a month should pass for the delivery to take place. Such information can be elicited in regard to return of missing person etc. Rahu and Ketu have not been allotted such periods by Kalyana Varma in sloka 17, Ch. 4. Sarvartha Chintamani, however, denotes 8 months for Rahu and 3 months for Ketu, vide its chapter 3 sloka 90. mtareafasiiat = amgaecfa: faa: eiaarfadt am: afisisadecre ueen arpa: afagat fercitet gareat ara: fagurguatae ai frrtgarcerfaararary uot 19-20. LORDS OF VEDAS AND WORLDS : Jupiter rules Rig Veda, Venus Yajur Veda, Mars Sama Veda and Mercury Atharva Veda. Jupiter denotes the Heavens, the Moon and Venus the world of the Manes, the Sun and Mars the world of mortals and Mercury and Saturn hell. wengizaaqia: tgafadeaerereaat aregeal ayfaqareaaa: YE: wavs: feaz: | qaaraAaginqeacy: frenfeqearet wary aeiltagran: qgee: atgenarar <a: Ren ## Page 55 Chapter 4 31 21, DESCRIPTION AND NATURE OF THE SUN: Thz Sum has curly hair, sharp mind, prominent appearance, majestic voice, and is not very tall. His eyes are honey-coloured. He is courageous, steady, and of a complexion which has a mix of red and green His feet are not conspicuous (i.e, small in size). He is bilious and has sturdy bones. He is great and majestie, He has fiery rays and square body, and wears safforn coloured apparels. Notes: The Sun has no hair on his head. He causes reddish clouds. He denotes tuberculosis, fever, physique, head, father, king etc. (Ref. Poorva Parasaryam). Mantreswara also describes the Sua as dealt with in various texts. He uses the words “qq a1g:’” which indicate that the Sun has long hands. Kalyana Varma’s words qget have been rendered as fiery rays asqq also denotes fire and st the rays (or hands), Similarly, Prithuyasas has used TEEKSHNAMSU in Horasara. The Sun has predominance of Satwa. He is said not to live in one place for long. His weakness causes damage to eyes, If ina nativity, a satwik planet is strong, he will have kindness, firmness, truthfulness, softness and respect for Gods and the wise. If Rajasik planet is strong, he will be skilful in poetry, literature, fine arts, sacrifices (religious), will have interest in the fair sex and be valorous. If Tamasik planet is strong, he will be short-tempered, foolish, indolent, and long- sleeping. The Sun, the Moon and Jupiter are Satvic planets. Mereury and Venus are Rajasic planets. Mars, Saturn and ‘Rahu are Tamasic planets. These descriptions are found in our present work and in various other texts, in many contexts. Now, the reader can easily understand these. dba: arafacitadt agrarsite: Saree Fat sig: qerfag aarfacaa: sat ag: atfeas: | ## Page 56 52 Saravali arvatenner: faadt cadre quit qaeiy wasaatshrgua: Yarraweaza4r uM 22, DESCRIPTION AND NATURE OF THE MOON: She has an auspicious appearance. Her eyes are beautiful She has mellifluous voice. She is fair in complexion, has an emaciataed body, is youthful, tall, curly and short hair, is learn- ed, soft, of Satwik disposition, beautiful, phlegmatic, amicable to friends, has pure (excellent) blood, is kind, fond of old Jadies, fickleminded, very fortunate, and wears clean apparels, Notes : The Moon is a cold body in the planetary scheme, is black in complexion (sarmeaq), has a round body, is windy and phlegmatic, peaceful, soft-spoken, auspicious in sight, indicates queen, mother, fare, water-born products, mind, flowers, salt, palatable articles, lead, pearl, zinc, ram ete, She drinks milk and water : (Ref. Poorva Purasaryam). The Moon does not have much hair She is more phle- gmatic than windy. She hasa mix of both old age and youth, (Phala Deepika). Bet: frgaataat geagdharfiaarhasaat ASAT BUTAT: TEA: Yea OTA A fga: afaadiataaer: freremrara- Fave: aTBiawTshT VTAHAG: ATAAMT: FH URW 23. DESCRIPTION AND NATURE OF MARS : The planet Mars is short; his eyes are reddish-brown in colour. He has a strong body. He is as bright as burning fire. He is not steady in disposition, He has marrow in bones and flesh. He wears red-coloured apparels. He is more intelligent and is courageous. He is an accomplished speaker (fatavarn). He causes injury. He has short and shining hair. He is bilious in disposition and is Tamasic. He is adventurous and wrath- ful and is skilful in hurting. He is blood-red in appearance. Notes: POORVA PARASARYAM states that Mars has ## Page 57 Chapter 4 33 cruel sight (ajzgftz), is bilious, liberal, lean and thick red, He lives through weapons. He is blind and is a poet. He rules neck. He indicates an army head, younger brothers, darkness, forts, vomitting, eating warm food, itches, wounds, accidents and diseases caused by fire etc., kingdom, wheat, gold, coral, abdo- men, lizard, ass, cat, tiger and such other violent animals, dog, poverty, tale-bearing, injuring, hatred etc. Mars has slender waist. He has attractive limbs. (Ref. Jataka Parijata, Ch. 1, sloka 55.) He has rough voice and a depressed belly. He is modest. (ide Horasara, p, 24). Varaha Mihira in his Brihat Jataka, Ch. II states that the planet Mars is R7am which is denoted to be Asubha Drishti or inauspicious aspect by the famous commentary Dasadhyayi. waraaadaa RyargaieaaAa- waaariisacatt fen: eqerar: eplafeaata ras | ae nermecareg haga ga: Prefers: aaeargetlfa aaaadt: oaraarat | ga: ues 24, DESCRIPTION AND NATURE OF MERCUR Mercury's eyes are reddish and broad. He speaks sweetly. Hi complexion is of green grass. He has strong skin, He is an extremely Rajasic planet. He is clear in his speech and is pure. He has a mixture of the three humours, ie phlegm, bile and wind. He remains delighted and has moderate beauty. He is skilful, and sinewy. He is agteeable to all in dressing and speech and wears green robes. Notes : Mercury is learned, emaciated, Vaisya (business - community), has a mix of the three humours, and is a comm- ercial planet. He is young and isa mathematician. His dis- position is to be jovial. He indicates drawing, fine arts, maternal grand-mother, friendship, relatives, heart, pearloyster, Rajasic disposition, delirium fever, forgetfulness, diseases of various Kinds and mixed eatables. He rules skin and has reddish, large eyes, He is of medium stature, sometimes firm and sometimes ## Page 58 54 Saravali unsteady. He speaks sweetly but stammers. He is adulterous and does not possess firm valour, He is truthful. This is how Mercury is described in Horasara, Sarvartha Chintamani, Phala Deepika and Poorva Parasaryam. faferqactaa: afraz: fagresara: fea: araes: giagantsarag: TAA: Fae | apag nical fadtafagent aatenerar: eit STATA SARAGAT: TATAT JR URE 25. DESCRIPTION AND NATURE OF JUPITER: The eyes of Jupiter are somewhat reddish-brown. He is learned in Vedas. His voice resembles that of a lion, He is a firm and is prominently Satwic. His physical complexion is akin to pure yellow metal. He has broad and prominent chest. He is always fond of virtues and is modest. He has firm and large eyes and is of forgiving disposition. He wears yellow apparels, is phlegmatic, fat and pre-eminent. Notes : “agtemeter” has been interpreted/by some comm- entators as “wearing excellent rosaries”. This view cannot be subscribed to, while I have rendered the same as having firm and large eyes. See ag=firm, veHz——large and mer= eyes. Jupiter has large eyes and hence his aspect on or occup- tion of the 2nd house confers large and beautiful eyes. He has large belly. He is a minister, has sharp mind, and is gold-coloured. He denotes abdomen, wisdom, work, hearing and auspiciousness. He consumes honey, ghee and Sweet food. He is virtuous and meritorious and is an expon- ent of mythology. He indicates happiness, Vedic rituals, Sacrifices etc. He rules Brahmins, sages and ascetics and possesses empirical disposition. (Vide Poorva Parasaryam). aredtiys: qaeae: qarfem: ated punrgianqerataarat gateqrara: | anit qeamarernlsfaguatararradt Uae steraraferfeateaa: caatata: fea: uREn ## Page 59 Chapter 4 38 26. DESCRIPTION AND NATURE OF VENUS : The planet Venus is beau‘iful, has long hands, broad chest and face, is very seminal, splendorous, has dark, short and extended hair, is of complexion which is a mix of yellow and green, is sensuous, windy and phlegmatic, very fortunate, wears multi- coloured apparels, is of Rajasic disposition, sportive, intelligent, broad-eyed, and has prominent shoulders. firgh freafactar: gragatd: faeretsera: : Teaereshttaga: caratam TT ya: eqaaalzatsirafaat cettsgfacarat a: Maa aeraiearat: FoUTFAT ATERAT: UU 27. DESCRIPTION AND NATURE OF SATURN : Saturn has red and depressed eyes, emaciated body, prominent veins, is indolent, black-bodied, and windy in temparament. He is a tale-bearer, He is rhuscular, unkind, foolish, has large nails and teeth, is very dirty, impure, Tamasic in disposition, fierce, short-tempered and old (worn out). He adores black apparels. Notes: He is cruel, lame and is indicator of misery, longevity, livelihood, death, disputes, windy diseases, indolence, devils, base men, uatouchables, sins, and legs. He is a eunuch, The present verse is taken verbatim by Mantreswara for his Phala Deepika, (except for minor replacement), vide Ch. I, sloka 14. Since our author has not described the nodes, please find following addition : RAHU:: He is of thievish disposition and belongs to a base caste. He is black in complexion, and denotes fits, fear from snakes, leprosy, loose motions, small-pox, tastelessness of food, worm infections, elephants, death and wealth. KETU: He indicates poisonous creatures, monkeys, rats, animals, poverty, snakes, evil spirits, wounds, fits etc. He eats insipid food. He also denotes debts, foolishness, illusion etc. He is a spiritual plaaet. Also see Phala Deepika, Ch, Il, slokas 33 and 34 for more information on the nodes, ## Page 60 56 Saravali Now, we have to understand, the use. of these planetary descriptions, qualities etc. as explained in the.foregoing slokas. If a planet influences the ascendant, its lord, its ocoupant, Moon sign lord, a bhava lord etc. the sphere, concerned changes accordingly. For example, if the 7th lord is influenced by Venus, the wife of the native acquires the qualities asoribed to Venus. She may be beautiful, be of Rajasic. dispositio intelligent, fortunate etc etc. If the ascendant or its lord comes in contact with the Sun the native may be baldy, cousageous, may like saffron apparels, may have sturdy bones, small feet, and be susceptible to T.B., fever etc. Similar inferences may be suitably made by the wise. : fearfy quiggnitaaa: qa-cgat cfaaaitanr: | wig: aga: afegivte aeegat gaget za gst. Qartst ara a wfeacdtey: aait gaat walg 1 atarmaar caacataat frarfetat a geet aa: uREw 28-29. NATURAL FRIENDSHIP, NEUTRALITY AND. ENMITY BETWEEN PLANETS : The Sun’s friends are Jupiter, Mars and the Moon, The Moon's friends are the Sun and Mercury. The Sun, the Moon and Jupiter are friendly to Mars. Venus and the Sun are Mercury’s friends. The Sun, Moon and Mars are friendly disposed to Jupiter. Saturn and Mercury are friends of Venus Mercury and Venus ‘are Saturn's friends. The Sun’s enemies are Venus and Saturn. The Moon has no enemies. Mercury is inimical to Mars while the Moon is Mercury’s enemy. Venus and Mercury are the enemies of Jupiter. The Moon andthe Sun are enemies of Venus. Saturn's enemies are the Sun, the Moon and Mars. If a planet is neither a friend nor an enemy of another one, there exists neutrality among them. aargaraag qa gea: Faar: 1 aenraheara: TesAcaes RUT NRO 30. TEMPORARY FRIENDSHIP AND ENMITY BETWEEN PLANETS :1f a planet is in the 12th, 4th, 2nd, ## Page 61 Chapter 4 37 10th, 11th or 3rd from another planet, then there is temporary friendship between the two. If the position is in the 6th, 7th, 8th, Ist, Sth, or the 9th, then there is temporary enmity among them. (This may be applied to a birth horoscope, horary horoscope or any such other context). fer-aefegsar & franifereaet fgeera feat nearest aeara faa: 1 feguaggaremt: gfaare wat afafegicgaear: aafafreraitar: u32 “31. FIVE KINDS OF CONSIDERATIONS OF RELA- TIONSHIP : (a) Should there be temporary friensdhip and natural friendship between two planets, then they become extremely friendly (afafiq7). (b) If there is natural neutrality and temporary friendship, there exists only friendship between two planets, (c) If there is natural enmity and temporary friendship, they are neutral in relationship. (d) Should they be naturally neutral and temporarily inimical, they are only inimical. (¢) If there is enmity both naturally and tempora- rily, then they are greatly inimical to each other. Notes: These rules are simple and need no clarification. However, an example is given thus: Suppose the Sun is in Taurus and Jupiter is in Cancer. They are mutually in 3rd and 11th, Hence, they are temporary friends in the nativity. They are by nature friendly to each other. Hence on account of these two sources of friendship, they become mutually extreme friends as far as the concerned horoscope is concerned. Now, see point (e) above. The Sun and Saturn are mutually inimical. If these two are mutually in 6/8 positions in a chart, they act in a highly inimical manner for each other. acaafa eararg dat aeteauafaa: aa t franfratuageaccaaria a Gat OAT UR qa veafa cfameadiacad fatal ita: agra’ yftgat aad aa gr wT: UaRU ## Page 62 58 Saravali 32-33. PLANETARY ASPECTS : Planets lend 1/4th aspect on the 3rd and 10th, half aspect on the 4th and 8th, 3/4 th aspect on Sth and 9th and full aspect on the 7th, from their positions. Saturn has special full aspect on the 3rd and 10th, Jupiter on the Sth and the 9th and Mars on the 4th and 8th. All planets aspect the 7th fully. fercaraereaagrgsd ae aafavigfrara 1 wet agra vgeg feat waeaa: navn 34, PLANETARY STRENGTHS : To assess the auspici- ous and inauspicious effects of a planet, its directional, posi- tional, temporal and motional strengths are important; for, without these, it is considered to be weak. ana sita-gat fearac-geit aatfea wa? wrenfe- aearfargfadt fearpafad etek eae ah faoratemdfeaa: gancie tal acter ag: amas afarantat aeqy Far TA ATA UA 35, DIRECTIONAL AND POSITIONAL STRENGTHS : Jupiter and Mercury have directional strength while in the ascendant (i.e. East), the Sun and Mars in the 10th (i.e. South), Saturn in the 7th (i.e, West) and the Moon and Venus in the 4th (ie, North). If a planet is in exaltation, Mulatrikona, own house, friendly house or own Navamsa and aspected by a benefic, it assumes strength. The Moon and Venus are strong in even Rasis while the rest are so in odd Rasis. This is called positional strength. Notes: Digbala or directional strength is found thus : Take the case of Jupiter. He gets full strength, under this heading, of 60 shashtiamsas, if he is on the cusp of the ascend- ant. If he is on the seventh cusp (ie. 7th Bhava Madhya), his Digbala is nil, In other places, it should be worked out by rule of three process. To speak deeply, Sthana Bala or positional strength is made up of: ## Page 63 Chapter 4 38 (a) Uchcha Bala (cxaltation strength) (b) Sapta Vargaja Bala (c) Ojayugma Rasyamsa Bala (i.e. strength on account of odd and even Rasis and such Navamsas) (4) Kendra Bala (angles) (ec) Drekkana Bala (Decanates) These five kinds of strength denote the positional strength ofa planet, which from part of shadbala, For fuller information, please see Ch. 27 and Ch. 28 of my English version of BRIHAT PARASARA HORA SASTRA. Serrafearearea afera: atear: frasashag 1 dara afaat factanaa: dqoarat ver: qarq gaeataoafsat | aeataa terrae nen 36. TEMPORAL AND MOTIONAL STRENGTHS: The Sun, Jupiter and Venus acquire strength during day time while Saturn, the Moon and Mars become strong during night time, Mercury acquires vigour at all times. The Horabala goes to Hora lord. masa bala (ntq¢—=month) to the lord of the month, Dina bala to the lord of the week day of birth and Abda (year) bala is credited to the lord of the year of birth. Malefies get strength in Dark Half while benefics become strong in Bright Half. The planet that is victorious in war, that is in its retro- gtade motion, or that is not combust become strong. The lumi- naries get strength in northern course. This is how Satyacharya detailed motional strength. Notes : Each day from one Sun rise to the next one is divided into 24 horas (or hours), The planet ruling the hour of birth is called Hora'lord and gets 60 shashtiamsas. The. first hora of the day is ruled by the lord of the week day itself.. For example, Mars rules the opening hora of Tuesday. The second one is ruled by the lord of the sixth week day. The third one is tuled by lord of the sixth week day counted from the second hora lord. Still an easy method is suggested here, so that the ## Page 64 60 Saravali reader need not memorise or make cumbersome calculations. Just note the first hora lord and count every alternative week day lord backwards. You get the hora lord successively. For example, Saturday has first hora ruled by Saturn, second by Jupiter, third by Mars, fourth by the Sun and so on and so forth. And calculations of Kala Hora should be done with reference to Mean local time. TaRAaA Tear: PREAH TAAL aA: | ard afarefagat gastt afar: caaiea: wae 37. AYANA BALA : Venus, Mars, the Sun and Jupiter are strong in Uttarayana while the Moon and Saturn are strong in Dakshinayana. Mercury is strong in both the cases. This is called Ayana Bala. qeatadesre: «= Aavareraneadaran: | qalfatca sar adtfear aaacrerray zc 38. DREKKANA BALA: Male planets are strong in the first decanate, female planets in the third decanate and neutral planets in the second decanate ofa Rasi. Planets are strong only when they are away from the Sun, as per Yavanas srarfaaristaas: warg: ya frarisafaet fare 1 matet neater a qa: aaa chatsmgal fears uzen 39. TRIBHAGA BALA OR TRIAMSA BALA : The Moon, Venus and Mars get this strength in the first, second and third parts of the night respectively. This is similarly enjoyed by Mercury, the Sun and Saturn in day time while Jupiter has it always irrespective of day or night. Notes : (a) Whether it is day birth or night birth, Jupiter gets 60 shashtiamsas of Triamsa Bala, (b) Additionally, one of Moon, Venus and Mars, or one of Mercury, Sun and Saturn get this strength according to birth being in night or day. For Example, there occurs a birth at 14 ghatis after night fall while the night duration is 30 ghatis. $o to say, birth is in the second one third of the night. As suggested, the strength ## Page 65 Chapter 4 61 of 60 shashtiamsas, on this score goes to Venus, This is again 60 shashtiamsas. wargayefaan: afrgaigatat afar: 1 warnfamartagarara fart STH: weott 40. NAISARGIKA BALA (NATURAL STRENGTH) : Saturn, Mars, Mercury, Jupiter, Venus, Moon and Sun are stronger than the other in the ascending order. (This is called natural strength). Should there be similarity in other strengths, then the one with greater natural strength prevails, Notes : Naisargika bala accrues to a planet according to its brightness, This is constantly expressed and is not variable, The Sun is the most luminous body and hence its natural strength is the highest. The darkest body Saturn gets the least. See the following table for an easy grasp : Sun : 1.000 Rupa Moon 0.857 Rupa Mars a 0.286 Rupa Mercury: 0.429 Rupa Jupiter: 0.571 Rupa Venus : 0.714 Rupa Saturn 5 0.143 Rupa (One Rupa equals 60 Shashtiamsas) aft scanaaifacfaara’ araaeat agalfate ary aqaiscara: wei Thus ends the 4th chapter ‘“‘Planetary Characters” of Kalyana Varma’s Saravali, ## Page 66 62 Saravali aa farang: Wii

uftada: afatt agatfafefeceata: 1 waerenget aft fa ATT nN 1, After discussing the Chapters Rasi Prabheda (Ch. 3) and Graha yoni Bheda or Graha Gunadhyaya (Ch. 4), Inow explain Misrakadhyaya (i.e. Miscellaneous Chapter) which is the most supreme of all, ara: caett gfe: area: aay facifsat. wa: 1 fans: casa wfaat vararet agt gfe Rn waa vata a Sher: eaea: cand gag’ gfea: ae: Yates: Tea: eee TTATTTT AN famat vagaad aeihrgat fitfsartay | qmeara Gat ae wt: AATeUTa: 2-4, AVASTHAS OR STATES OF PLANETS: Planets have nine states of being, viz. Deepta, Svastha, Mudita, Santa, Sakta, Nipeedita, Bhita, Vikala and Khala, A planet in its exal- tation is said to be in Deeptavastha, In its own house, it is in Svasthavastha, friendly house -Muditavastha, in beneficial Vargas Santavastha, with bright rays Saktavastka, in combus- tion Vikalavastha, if defeated in planetary war Nipeedita, in malefic Vargas Khalavastha, and if in fall in Bhitavastha. Notes : The indications of the above mentioned Avasthas are given below : Deepta (at) = radiant Svastha —(#aza) = confident Mudita (afea) = rejoiced Santa (ava) = peaceful Sakta (aaa) = strong ## Page 67 Chapter 4 63 Nipeedita (fatifsa) = oppressed or hurt Bhita (ata) = alarmed Vikala (fasq) = mutilated With the help of the said explanations, we can easily understand the effects such planets will reveal. The Sun and the Moon are not subjected to Nipeedita state as they do not involve in planetary war. Vikalavastha does not apply to the Sun for he does not get combust but is the cause of combustion. Saktavastha can however be applied to the Sun too as he is obscured in solar eclipse. Apart from the said nine states, Sanketa Nidhi enlists 12 kinds of different states of planets. Please see for more details, Ch. V ibid. There are 27 Graha Samayas (wgqaa) i.e. planetary conditions. These will help us know asto what a planet is doing at a particular moment, with reference to cither birth or query. Such positions reveal specifie results. How to calculate these positions and the effects thereof are noted below : Find out the number of signs from Aries to ascendant. Again find out in what number of sign, the planet for which waa (Samaya) is required, counted from Aries. Multiply these figures mutually and again the latest product be multiplied by the total number of Dasa period years of the planet as per Vimshottari dasa scheme. Divide this by 27 and the remainder indicates Graha Samaya (Some scholars, however, advise that the planet’s position is to be counted trom Lagna instead of Aries. It is wrong counting the planet’s position from . Aries as the sloka clearly says 3arfefeaatatiq vide Jotisharnava Nayaneetam) Let us assume that in Virgo Lagna chart, the Moon is in Sagittarius. Hence, we count six signs from Aries through Virgo Ascendant and get 6. Again from Aries to Sagtttarius (Moon sign) we get 9. Multiply 9 by 6 to get 54. The dasa period of the Moon is 10 as per Vimshottari dasa. When we multiply 54 by 10, we get 540. This when ## Page 68 64 Saravali divided by 27 yields no balance and hence the 27th Samaya is denoted. Now the scheme of Samayas and their effects : 1. Sana: good family, children, respect, success and position, 2. Vastradharana: precious stones, money, position and clothes. 3. Pundradharana : dear to people, gains in foreign count- ries, hard work and honour. 4. Upadesa: lands, conveyances and happiness. 5. Siva Pooja : fond of lands, royal wrath, expenses and litigations. 6. Aaposana : wealth, fond of wicked people. 7. Vishnvarchana : bile, grief, highly learned. 8. Vipraradhana : fortune, gains from lands, success over enemies, rich relatives. 9, Namaskara : soft-spoken, Conveyances and Capability to speak on cither side in arguments, 10. Adri Pradakshina : bilious diseases, dysentery, tions and penalties. 11, Vaisyadeva : position with king, good family, peren- nial progress. itiga- 12, Athidhi Satkara: Cheat, jimmicks and monetary gains. 13. Bhojana : sick, dismissed from the circle, cheating. 14, Ambhapana : bad meal, bad'acts. 15. Ahamkara : egoism and enmity with people. 16. Tamboola : good position, high learning, money and fame of high order. 17, Nripalapa : respect, pions disposition, diviee cows. 18. Kireetadharana: big position in army, learned, wealthy. ## Page 69 Chapter 5 65 19. Ekanta Sambhashana : lazy, soft-spoken. 20. Aalasya : abundant education, lazy, careless. 21. Sayana : very .short-tempered, sick, disputes in family. 22. Amritapana : foolish, harmful, blaming elders, des- truction (Some texts prescribe good results which only seem to be sensible.) 23. Madhupana: health, good children, beautiful wife, rich food. 24, Dhanarjana : respect, much wealth, skilful. 25. Bhikshatana : loss, bad teaching. 26. Nidra : long lasting diseases, drunkard. 27. Sambhoga: attached to base women, cunning and revengeful. aha facie gaa: sarafaearfiaaafcgat: 1 werarfafgatal ararrae RT ATES: UU 5. EFFECTS OF A RADIANT PLANET: Should a planet be in Deepta state (radiant) at birth the native burns his enemies with the fire of his valour. He gathers all kinds of wealth. His (band of) elephants soak the surface of the earth with the juice or ichor exuding from their temples. (That is, the native will own a large number of elephants. See the simulta- neous literary ability of Kalyana Varma. A number of such comparisons can be found in this work.) Note : Please see notes under sloka 13 of this chapter for more information. wea: atifa seal conf gens saeaicarery aaaavediaed Terrragranteatey un 6. EFFECTS OF A CONFIDENT PLANET: Should a planet be in Svastha (confident) state at birth, the native acquires gold, family ctc, He will bea justice in a king’s employ. He will own houses and will amass grains. His family will prosper. ## Page 70 66 Saravali Notes: This simply means that the native will acquire jewels, is capable of holding an important legal position, and will own houses. He will be never short of eating comforts. gfet faaafa gaat farfadterancerafeget: | fafaaanarieaa: ancagaare axy waft won 1. EFFECTS OF A REJOICING PLANET: If a planet is in Mudita (rejoicing) state at birth the native will be pleasingly disposed, will have wife, gold, diamonds etc. will win the entire band of his foes, and will enjoy all kinds of comforts in life. ae carafe: Geer asta: aaa: | faarq aetaerel eae) TAA ANT ust 8, EFFECTS OF A PEACEFUL PLANET : If a planet is in Santa or peaceful state at birth, the native will have peaceful mind, comfort and wealth. He will be a king’s minister, will be learned, helpful to others, religious and fortunate. eilacrareatedfacata gaa: aa faataatta: 1 afaa: aawaea a waared waft faeara: nen 9, EFFECTS OF A SAKTA PLANET: ¥f a planet isin Sakta state (ie. strong or powerful by virtue of being with bright rays) at birth, the native will have wife, clothes, scents, garlands etc. He will be famous, liked by all and have his name spread all over. geaeatfatreteha: stead dfearet 71 agai facia argfaatenfiedaca: ugon 10, EFFECTS OF A HURT PLANET : Ifa planet is in Pidita (hurt or oppressed) state at birth, the native will be subjected to grief and sickness and will have enemies. He will be deprived of his own people and wander from one country to the other (i.e. he will not live permanently in one place but will wander all over), ## Page 71 Chapter 5 67 agers tren weqeraat: witfeat fegat | arergrariar fafret ata ded ae sea: gen 11. EFFECTS OF AN ALARMED PLANET: Should a planet be in Bhita (alarmed) state at birth, the native, even if he were a king with varied paraphernalia, will be troubled by enemies. He will lose his men. He will be defeated and will become poor. Notes : If a planet is in fall at birth, its effects are that even a rich person loses everything and becomes poor. He will not have any relatives. This is more so if the planet rules the horoscope, without Neecha Bhanga. eararrafcae: freeet afer: saris Teta 1 facaeaact faae fegacdafeafaars nea 12. EFFECTS OF A MUTILATED PLANET: If a planet is in Vikala (mutilated) state at birth, the native will be deprived of his place or position, dirty-hearted, poor and will wander here and there. He will be frightened by his enemies, AAMT: THTTTATAAA laa: | awarfa atten sani andfae gua: nea 13, EFFECTS OF A PLANET IN KHALAVASTA: Should a planet be in Khalavastha (i.¢, in various malefic divi- sions), the native will grieve in sorrow due to maintaining his wife, (Le. the native cannot maintain even his wife), will lose all his wealth, will have an impure mind and be never free from miseries. Notes: The Avastha of a planet can reveal special effects in its dasa concerned. See the following explanations : 1. Deepta: Kingly status, enthusiasm, courage, money, conveyances, gain of wife and children, happiness, honour among relatives, learning and 10yal honours (Sarvartha Chintax mani, Ch. 13). ## Page 72 68 Saravali Destruction of enemies, acquiring elephants etc., courage and blessings of Lakshmi in all respects. (Manasagari, Ch. 4) 2. Svastha: Comforts, wealth through king, learning, fame, delight, greatness, wife, children and virtues. (a. fa.) Conveyances, wealth, jewels, abodes, position as army chief in the king’s employ and success over enemies. (aT @o)* 3, Mudita (Harsha) : Clothes, lands, scents, sons, money» courage, listening to Puranas, songs, charitability, conveyances and ornaments (ge fa.) Happiness of ornaments and jewels, delighted state of mind and destruction of enemies. (RTo ato) 4, Santa : Happiness, courage, lands, sons, wife convey- ances, learning, and royal honour (we fae). Delighted state, minister of a king, many sons and friends, liking for sastras, and helping others, ("ro #0) 5. Heena : Loss of position, enmity with relatives, blames, mean profession, forsaken by his own men and troubled by diseases. (we Fao) Poverty, loss of money, fear from enemies and king, interest in illegal acts, loss of splendour and enmity with own men. (To to) 6. Dukhita (inimical house) : All kinds of miseries, displea- sure from kings and thieves and wandering in foreign countries. (@o Fao) 7. Vikala : Mental dejection, death of father etc., harm to wife, sons and conveyances. Loss of strength, trouble from enemies, loss of minds, friendship with bad people, wandering and obeying others. (ate ate) 8. Khala : Disputes, separation from his own men, loss of father and destruction of wealth and lands. (a> fo) jarvartha Chintamani—Ch. 13, =Manasagari—Ch, 14, ## Page 73 Chapter 5 69 Worries on account of wife, wandering in foreign coun- tries, loss of money, miserliness and anger, (ate ao) 9. Combust : Many sins, loss of learning, fame, wife and children. (go fa.) seat fete a ca arseafegera 1 areeaistrageared cat cateasfaatea nee 14. RETROGRESSION IN EXALTATION: If a planet is retrograde while in exaltation, it produces no effects (ie. nothing good will happen). This is the view held by some. Even if it is in exaltation by its entry in retrograde motion from the next sign, (for example, Jupiter entering Cancer from Leo), the effect is same, for it takes unduly long time in such traversion. Notes : afaam indicates a planet (i.e. from Mars to Saturn) entering the previous sign while in its (R) motion, for example from Taurus to Aries. Many writers hold the view that a planet if be retrograde while in exaltation loses its potence and conversely if in fall while in its retrograde motion, it acquires strength and acts favourably. waeatfxan: Sesaat vata gait carga AeA: | weft faaqerfzat at ald sata: agiaefa nex 15. DIFFERENT EFFECTS: A planet in exaltation is considered highly strong. It is medium in strength in its Mulatrikona Rasi or own house. Its strength is only nominal if it be aspected by a friendly planet or be in a friendly Rasi. Notes : The idea behind the suggestion is that a planet in a friendly Rasi or with a friendly planet’s aspect is not superior to the one in its Moolatrikona Rasi while the one occupying its Moolatrikona Rasi is second in strength to the planet that is in its exaltation. ## Page 74 0 Saravali gaasfacen aeame: waa maAag: | eat fealaanh caetaarra eae FUE mifgrmarage: saratfrormose: gafeqe: | asfagate Fat qafrargerarfarafa: ugon 16-17. The elders among Yavanas say that the Moon is of medium strength for ten days commencing from Sukla Padyami, i.e. first day of Bright Lunar Half. During the following ten days (ie. from the llth day or Ekadasi of Bright Lunar Half through the Sth day or Panchami of Dark Lunar Half or Krishna Paksha), she is exceedingly strong. And during the third ten-day period (ic. from the 6th day or Shashti of Dark Lunar Half through the New Moon day or Amavasya) she has very little strength. If at birth the Moon has brilliant rays, is bright circled and full, it makes the native an unencounterable king. Notes: saet—=bright. vsq—= circle or disc of the Sun/Moon, and hence it is “‘bright-circled””. This sloka highlights the importance of full Moon in a horoscope. aeareaticaerratay ararfratsts at aeT | ea grata aqat wet qa ae ues 18. GOOD RESULTS IN MID-LIFE: If at birth the lord of Moon sign or the lord of the ascendant or Jupiter be in Kendra (angle), the native is happy in the middle of his life. Notes: Prithuyasas in Horasara states that if the lord of the Mooi sign or the lord of the ascendant be in angle along with Jupiter, the native becomes happy in the middle of his life (See Ch. 16, sloka 14). Kalyana Varma stipulates that Jupiter in angle singly is enough to cause the said. results. aaa at TieRecaATATEAA | grocaritared cay fetaey weaTUT UREN ## Page 75 Chapter § n gramgaaarat | feist farritaarara: warfaraeged «= aafag «= aetafrdafat Rou 19-20. The effects revealed by various Rasis will corres- pond to the strengths of their lords. Should two planets have identical strength, the one with higher Naisarga bala (natural strength-vide sloka 40, Ch. IV supra) will prevail. According to Chudamani Acharya the ascendant's strength equals that of its lord. Notes : Suppose, the lagaa lord and 6th lord have equal strength in a Leo Lagna chart, the lord of Lagna being the Sun and the 6th lord being Saturn. Among theso two, the Sun has more Naisarga bala than Saturn and hence the native is stron- ger than his enemies. faafazar: fae frets? crnaanaer | ged arifaad ge gedtes faaterneg sat: uae grain aa fratat cai g wtreT) seat areata geen feeders: wer Fare UR orakaatasa wahadat: crete Wea: | zaanm dag a fasta cad art Ra grag feet wafrct ai a gy famine cfarer gat <a: fae uz 21-24, SWAKSHETRA, MULATRIKONA ETC. : In Leo, upto 20 degrees, it is the Sun’s Mulatrikona and the rest is his own house. The Moon’s exaltation zone is the first 3° of Taurus, with the remaining portion being her Mulatrikona. Upto 12° in Aries, Mars is in Mulatrikona. The rest is his own house. Mercury in Virgo has the first 15° as exaltation, the next 5° (ie. 15° 1’ to 20°) as Mulatrikona and the remai ing portion is termed is own house. In Sagittarius, first 10° is Jupiter's Mulatrikona, with the rest being own house. The first 5° in Libra ig Mulatrikona of Venus and the balance his ## Page 76 n : Saravalt own house. Aquarius is Mulatrikona for Saturn im the initial 20 degree portion (as the Sun has in Leo) and the last 10° in Aquarius is his own house. Notes: Mercury is the only one planet that is exalted in its own house, Hence, in Virgo, it has first 15 degrees as its exaltation, the next 5 degrees as Mulatrikona zone is a stronger placement in preference to its own house zone, ‘The exaltation zone is still superior. wateafeaa: gaa sactfe qo atesineg fame fegufetseaq) ard guen feat cane cad qaad wat: feacaiferata wen 25. EFFECTS OF EXALTED PLANETS ETC.: If a planet is exalted, it gives auspicious results, to full extent. It is futile if in debilitation. The results are limited in an enemy's camp. The auspicious effects given by a planet are 1/4th ina friendly house, + in own house and 3/4th in Mulatrikona Rasi. Notes: The effects revealed by a planet are: 25% of its full capacity if in a friendly house, 50% in own house, 75% in Mulatrikona and 100% in exaltation house. In enemy’s camp, it is less than 25%. Thus its status gradually increases as under : Enemy's house, friendly camp, own house or Swakshetra, Mulatrikona and exaltation Rasi. These positions become better in the ascending order. While in debilitation, it gives no auspicious effects. Neecha Bhanga Raja Yoga, is however a different aspect, and should not be handy for all practical purposes. ateeit: acta aati ord wi oa fefeefth fad may wead fart fagitsquer wat at a ae feaaaifenatet uegu ## Page 77 Cha, 'pter 5 3 26. INAUSPICIOUSNESS OF PLANETS: A planet is fully inauspicious if it is in its debilitation; it is somewhat house (than in debilitation). Its inauspicious it is exalted, 3/4th in friendly house, 4 in own house and 4th in Mulatrikona Rasi, Notes: This isa converse process while the previous sloka explains auspicious results. The inauspicious effects are 100% in debilitation, somewhat less if in inimical Rasi, nil if exalted, 75% in friendly Rasi, 50% in own house and 25% in Mulatrikona, Draw a comparison as under : Position Good Bad Debilitation Nil 100% Inimical limited better than fall Friendly 25% 15%, Swakshetra 50% 50% Mulatrikona 715% 25% Exaltation 100% nil For example, from the two slokas in question, we can infer that if a Swakshetra planet can be auspicious to the extent of 50%, a planet in friendly house can give good effects only to the tune of 25%. aterfaat: afaqgerre freer ate wat fegag a aaeatar: | aa fan: gaacria faaraata oraria arf geet ofcatiafa non 27. The planetary combination that produces utpata (serra), the planet that is combust by the Sun, with less brilli- ance, which is in debilitation, in enemy’s camp or that is defeated in planetary war: such a planet not only loses its potence to be auspicious but also becomes capable of bestowing malefic effects in full. Notes: The rule of combustion does not apply to the Sun while defeat in war does not apply to both the Sun and ## Page 78 74 Saravali the Moon. The nodes do not also involve ia war nor do they have rays to become combust, as they are only mathematical points, seaae ata: oi fargta ag: sereafat) Tara afaed faatwacary aeaftearq ust radiate @ alga: sqeaaaaradqeraray | faanacdged! safe staffed gery nen anftarafagua gfeacfard qorea wee | fasdreraagadt safe fereereafafe farcry Ron 28-30. EFFECTS ACCORDING TO EXALTATION ETC. : A planet in exaltation gives all kinds of wealth. It confers ministership or leadership over army, if in Mulatrikona Rasi, If it is in own house, it gives happiness, money, grains, wealth etc. In a friendly house, it gives fame, splendour, abundant good fortune (mfaaai), long-lasting wealth and also wealth through king. A planet that is in its own hora makes one courageous. Notes: The word “Hora” in sloka 30 is generally interpreted as house so that it applies to all the seven planets. But, in this context, in sloka 29, ‘‘own house” has already been discussed and hence, the word “‘Hora” in sloka 30 means “half” i.e. lunar or solar hora. Thus, the last line of sloka 30 should be applied only to the position of the Sun and that of the Moon. This is the strict translation aspect, while in practical aspect, ‘‘hora” can mean house and a person can be valorous if a planet is in own house (or if the luminaries are in their own hora). PARTHTUAAATNA FUN ae: HVT wrramangaa: Hf ged sfag aw nae acaiaaaratat: aefaa faratateaq facainarata: mize eITRTER ST RN ## Page 79 Chapter 5 5 faaiaates aa faracdted guifad gatqs quataaaates: ged gaienfad ear | gai semnfad gevtg gated a naan 31-33. A planet in its own decanate confers virtues while the one in own Navamsa makes one famous. Courage, wealth and fame are bestowed by a planet occupying its own Sapthamsa. One becomes devout and helpul if a planet is in its own Dvadasamsa, A planet in own Trimsamsa gives happiness and good qualities. When a planet is aspected by a benefic planet, the native becomes wealthy, famous, fortunate, chief of all, beautiful and happy. Notes : We have already known to work out the various divisions in the earlier chaptcrs. Different uses are to be suita- bly understood for different divisions. qeiwaraea 3 avila sayin BATRA | get oseafad aed ooeetedte Tau eqraada ata: feacdteageet AVaTeT: 1 de farwafae: eararat Haar KN 34-35, If a planet is with ojha or Yugma Bala (i.e. strength by being in male or female Rasis), the native is worshipped by the public, expert in arts, pleased, immune to sickness and prone to fear of other worlds. A planet with positional strength gives perennial happiness, friendship, courage, fixity of mind and independent profession or work. Notes: The Moon and Venus get cach half rupa by staying in an even Rasi. Another half rupa is obtained by their stay in even Navamsa. Should they be in odd Rasi or Navamsa, their score is nil on this count. Similarly, odd Rasis and odd Navamsas give half rupa each, for the rest of the S planets. This strength is designated as ojhayugma Rasyamsa bala (or strength by oddjeven Rasi and Navamsa position) as shown under the heading positional strength, vide notes for sloka 35, Ch, IV. ## Page 80 6 Saravali armaaaged aafa cafe wArae: geal art aeafaqauareraterfad = Fem ug amaaagint aenfgferiagd eafefitt (alfa fart aga afe at at atertsedt at) uzun qafaaret vafeqet vafaxet aafaerat: wart faeries 9 Aprdtiaafaa: ngs 36-38. A planet with directional strength takes the native to the direction ruled by it and gives clothes, jewels, conveyances etc. And the native is happy in such a direction. A planet with Ayana Bala similarly takes t'e native to its direction and confers various kinds of wealth apart from fame. In both the cases, the planets should not be combust or debilitated. If a planet has Cheshta Bala, it sometimes gives kingdom, sometimes respect; sometimes money and yet some- times increases the fame of the native. Notes: We have already explained Digbala or direc- tional strength, vide notes under sloka 35 of Chapter 4. Suppose, Saturn is in the 7th, without combustion or debilitation, then it takes one towards west (see sloka 8, Ch.4) and gives success. Similarly, Ayana Bala and Cheshta Bala are explained in slokas 36-37 of the previous chapter. afimareg neretat: qr TIsaTat TET: | cre eqafrat dat gf ae qarety nen 39, EFFECTS OF RETROGRADE PLANETS : A benefic if retrograde is strong and is capable of conferring kingdom. If a malefic is retrograde, it causes grief and purposeless wandering. Note : According to Bhavartha Ratnakara, a malefic does good if in retrogression, see sloka 16, Ch. 13. But Jataka Tatwa (A-71) attributes strength equal to exaltation to all such planets irrespective of being malefic or benefic. ## Page 81 Chapter 5 at raeaatizranmageigaaraae fazarft 1 ganlad fag usd a fafaterarerig wvon 40. AUSPICIOUS PLANETS: A planet with clear rays, or that is conjunct with the Moon or that has won in a plane- tary war, is capable of bestowing complete happiness and kingdom that cannot be siezed. ufafaraaginant = atdafeazar afeaafa aaa wala a cet aaa: FoR: sgt 41. DIVA BALA AND RATRI BALA : A planet that has Diva bala or Ratri bala is eapable of conferring lands, elephants etc, Such a native defeats his enemies with courage and achieves kingdom and wealth. Notes: Diva Ratri bala is also called Nathonnatha Bala which forms part of Kala Bala. Mars, Saturn and the Moon get this at night while Jupiter, Venus and the Sun get this during day. Mercury is strong inday and in night. For details, see my English version of BRIHAT PARASARA HORA SASTRA. fayt faq aaastfertafeaagiten: awariqgar dled cazarg aa a ae a en 42. EFFECTS OF LORD OF YEAR ETC.: The lords of the year, month, week and Hora improve two-fold in their dasas happiness, wealth and fame respectively, that is, the lord of the month gives two fold results as against year lord, the week lord two fold of month lord and the hora lord two fold of week lord. Notes : Here, hora means Kala Hora or planetary hour, which has been narrated in the notes under sloka 36, Ch. IV. etterrrginarny fart TaTgacazary ean 43. EFFECTS OF PAKSHA BALA: A planet with Paksha ## Page 82 8 Saravali Bala destroys enemies and confers diamonds, robes, convey- ances, wife, gold, land and fame. Notes : Benefics get Paksha Bala during bright fortnight while malefics get this strength in dark fortnight. Malefics are the Sun, Mars, Saturn, decreasing Moon and ill-associated Mercury. Benefios are Venus, Jupiter, well associated Mercury and waxing Moon, For calculations of Paksha Bala, please consult notes given in my English translation of Brihat Parasara Hora Sastra. AHAATATCAT AAAS AT ANT RT: TAT | ued vet: seg: ated a aAtearefiery ues 44. EFFECTS OF A PLANET WITH ALL SOURCES OF STRENGTHS : Should a planet have all kinds of strengths stated so far, and be bright with unobscured rays, it confers kingdom exceeding the desires of the native. Notes: In short, clues have so far been briefly given to Proceed on the basis of Shadbala calculations. Notes have been made, in this context, as elaborate as possible inasmuch as we have given relevant detailed explanatory notes. The zealous reader will realize our limitation and will do well to consult Brihat Parasara Hora Sastra (my English translation) and also Sripati Paddhati (translation by Sri V.S. Sastri). WARAIVAMAZA: FET- eauftar: pfafaal feta: 1 HATA TAT TTT ATT ahangaagt: ger waft en 45. BENEFIC PLANETS WITH ALL-ROUND STREN- GTH : If, at birth, benefic planets possess all-round strength, the native will have good habits, be truthful, upright (sit), beautiful, splendorous, and be an expert in all deeds, respectful towards the wise and Gods, and will be blessed with scents, garlands, robes, ornaments ete, ## Page 83 Chapter 5 9 gear: FRafacar frorarafacsr: 1 argtes: anargrra Tat fraT: | HRT BAT aaa Alaa: FAEAT: qrragaaga: frgar: Fe: wee 46. MALEFICS WITH ALL-ROUND STRENGTH : Should malefics be with such all-round strength at birth, the native will be a miser, will do bad acts, be selfish, jealous of virtuous people, intent on promoting quarrels, wicked, tortu- rous, dirty, ungrateful, slanderous and ugly. wafeadiadeartt =o agra atadfeet) wafaatamarai a gare ace atfaat uso veret edteadeatat gafaedfrer waq1 aaaanatt A det ate aafeat wes atari agri a za Reef) aaARATTA sera J TAT HAG uvan aa: gat aster aledcadteaz: 1 agate dt afsiet Ret em YON 47-50. PLANETARY STAGES (aur or waeat) AND EFFECTS THEREOF: It is boyhood (ata) if a planet isin its own house or friendly house. In Mulatrikona Rasi, it is in youth (gHr<) and in adolescence (gaf) in exaltation. It is said to be in old stage (ggraear) if it occupies an inimical house. A planet in debilitation is im extremis (we). The corresponding effects are felt in the respective planetary dasas ie. periods. The results for such stages are respectively happiness, virtue, kingdom, sickness with debts, and death or expenses. Notes : The zat or qaear explained above are by virtue of a planet’s occupying different Rasis. Jataka Tatwa (A-68 and 69) states a different rule. In odd signs, according to the longitude obtained by the planet, itis in infancy, boyhood, ## Page 84 80. Saravali adolescence, advanced age and in extremis, Each Rasi is to be made in 5 parts of 6° cach. This order is reverse in the case of even signs, ie. “infancy” is at the end, preceded by boyhood and so on and so forth. A planet in adolescent stage is capable of giving full results (i.e. 12° 1’ to 18° of odd or even Rasi). quiridgaaier: daracirat —afefa faeaet: qeate: met qaira wT uxgn gafraateaay a aaa: darrateat: eat: | magguaeafacar: ateat: Heat: KAMAE: UAW 51-52. EFFECTS OF PLANETS IN ODD AND EVEN RASIS : A planet in odd Rasi with strength makes the native courageous and a warrior. If itis weak in odd Rasi, the native is cruel and dullwitted. A planet in even Rasi gives soft nature, fear for quarrels, love for water, flowers and clothes, good fortune, health and protection of own men. afr wemrqnifactaarat areaeat frererere: Gea: WAN Thus ends the Sth Chapter “‘Miscellaneous Matters” in Kalyana Varma’s Saravali, BT DABRATAT: URN

waifratuggeat afe tag afer: 1 mead HHT ey: Besta etAAT un 1, KARAKA PLANETS (PLANETARY CO-WORKERS) : Planets posited in own house, Mulatrikona or exaltation and ## Page 85 Chapter 6 81 simultaneously in (mutual) angles become mutual Karakas or significators. Such kind of yoga Karakas (co-workers) arecounted only in regard to Lagna’s angles. This view is held by Acharya Hari. cleat area: Heiteart agetfafenty Re get cage: ceed aTeT TAN 2. For example, Saturn in Libra while Cancer ascends containing Jupiter and the Moon, and Mars with the Sun in Aries become mutual Karakas. Notes : In the said example given by our author, Cancer ascendant has Moon in own house and Jupiter in exaltation; Saturn is exalted in Libra, the 4th from Lagaa while Mars is in own house in 10th andthe Sun .is exalted in the 10th in Aries. Thus, these 5 planets are mutually in angles and either in exaltation or in own house. Hence they promote the mutual significations and act favouring the native. Now, see the chart as per the sloka : [Lagna Jup Moon| Some authors (not Kalyana Varma) say that planets mutully angular though not being so from ascendant, become mutual signifactors. But this view is not acceptable to even Chanakya. Kalyana Varma clearly requires the planets to be in angles only from the ascendant and not even from the Moon, not to speak of non-angular state from the ascendant. Horasara,

Ch. 16, sloka 11, however takes into consideration such mutua ## Page 86 82 Saravalt angularity irrespective of Lagna at birth, Now, we have to understand what is the effect of such Karakatwa, By being in such Vargas and also in angles from Lagna, two planets act on behalf of each other. In the example case, though Saturn is the lord of the 8th and evil for Cancer, he will reflect the qualities of other good planets, say Moon-Sun and promotes the pros- perity. Neither the mutual aspect between the Sun and Saturn shall be adverse in this case. THAT TAIT Ferar Te: BTTHT: SATLATAT: age a facts fated afer area: nan 3. Planets posited in exaltation, friendly Rasi, own Rasi or Amsa also become Karakas. The Sun in the 10th as above becomes greatly significant. This is Chanakya’s opinion, arreat: gadeat aarneatearl IAT: Aa varansta Sfaaegha + aaa GataETy wu 4. Planets though not in Vargas like own house become Karakas if they are in Lagna, 4th, 10th or even the 11th. But this view is not acceptable to great sages. Note: The author thus does not subscribe to this view. aragh dqa: sresfagt: serait arity fafarfataagedt waft atat a ate: nen areata aaargqad attg atfaat efar mentenat faa: areavarfefratea: gir 5-6, EFFECTS OF (YOGA) KARAKAS (CO-WORKERS): Even though a person may be born in base strata, he will become chief if he has Karaka Grahas. One born in royal family without doubt becomes a king, in sucha case. While analysing the Yogas, such Karakatwas are alone important and effects should be declared only on that basis. fa wearmanfacfrarat arcracai BIRHTEATT: TS: 1141 Thus ends the 6th Chapter entitled “( Yoga) Karakadhyaya” in Kalyana Varma’s Saravali, ## Page 87 BA BIBEATA: bli

veaaitagaiageat fearfeaaara 1 ara aagarat feasadise? ferzaea nen 1, LORD OF WEEK DAY ETC: The Sun, the Moon, Mars, Mercury, Jupiter, Venus and Siturn rule the week days etc, Whichever planet becomes the lord of the first week day in the month of Aswinain the year of Aswina, will become the lord of month and year. Notes : Whichever planet rules the opening week day of the year shall be the year lord. That is, ifa year starts on Monday (ruled by the Moon), the year lord is Moon. Similarly whoever rules the first weck day of a month, is designated as lord of the month. weafaarsagat: FAM Teste TAIT: | fgateagher: wafezareaaifentizaag un aratfearagfoar vated: acai feaar: 1 weafat: sareqr wafer: sara ey ua 2.3. The fourth planet counted from the lord of the first year rules the second year. Similar counting of fourth lords for the subsequent years should be made to know the lords thereof, There are 24 horas (i.c. planetary hours) in each day (from one Sun-rise to the next Sun-rise). The first Hora is ruled by the lord of the week day while the subsequent ones are ruled by the lords of the sixth week days thereof, Thirty (Savana) days make one (Savana) month. To know the Jord of the week day in particular month, the months past should be multiplied by 30, increased by one and divided by 7. The remainder represents the lord of the week day counted from the earlier week day lord. ## Page 88 84 Saravali upleangaridaaraatier-aerdtary tl arat fear grasfrasrdearary us 4, A Savana month has 30 days and each month, viz. Chaitra, Vaisakha etc, commences with the first day of Bright half and ends with the 30th thithi (i.e. New Moon's day or Amavasya). meq TeEM ATA AeA TE TEAS FA aferateaae® afeicam a ateT nun weet ugicat ata grereaHraaTayg 1 qefaagat at Saag HAA ITH: NEN 5-6. BHAVA EFFECTS : The good effects relating to a bhava can be better reaped if an enterprise relating to that bhava is started inan ascendant ruled by the lord of that bhava, or when the lord thereof is in an upachaya house, or on the week day, Hora, year or month ruled by that bhava lord, The good effects will be 25% by year lord, 50% by month lord, 75% by lord of week day and 100% by hora lord. Notes : Suppose one wants to buy a conveyance. This aspect is ruled by the 4th lord. Let us assume it is Mercury, Hence a hora ruled by Mercury will be 100% beneficial for that purpose. Alternatively an ascendant ruled by Mercury, or when he is in 3, 6, 10 or 11 of another ascendant may also be useful. aatinnaaaimettaaagaaar ss Perea fer arene THe HAY: aa: won afagarivanlawmararameagaeaanny t qamartaaadtaafargsrs: neu watraaraaantete arent faa fafaqafarargenta frre eayuila: neu afaiafaateramiguataagagrarrm 1 argerenrfaaretiaerinaay: aa: got ## Page 89 Chapter 7 85 ATSeqar at eerag eater faalngeeesy | FAY -AA-ATAT-SSAA-ATA-ATA-TAT TA: UU qaafauaqaufaagrdeenicagadiag | mrafrarmtarfyarcray: OF urea AqaaHT AA BHF AATAT IR SAAHTATY | araedrorparaataaterray: atfe: nea 7-13. PLANET’S RULERSHIPS : The Sun rules snakes, wool, hills, gold, weapons, poison, fire, medicines, kings, Aryas (or foreigners in general), river banks, forest, wood and Mantras, The Moon indicates poets, flowers, eatables, beads, silver, conch, salt, water, arrow, robes, ornaments, females, ghee, sesamum, oil and sleep. Mars rules blood, copper, army, red cloth, mercury, minerals, earth, king, destruction, swoon- ing, bile and thieves. Mercury rules Vedas, writing, sculpture, medicines, expertise, ministership, speech, jokes, birds, couples, fame, Vanaspathi (ie. a large forest tree which bears fruit apparently without any blossoms) and gold. Jupiter rules auspiciousness, virtue, physical stoutness, prowess, preceptor- ship, deputation, city, state (province), gold, bed, conveyance, Position, grains, residence and sons. Venus rules diamonds, ornaments, matriage, scents, friends, wreaths, females, cow dung, diagnosis (frata apart from meaning diagnosis also indicates end, purity, rope to tying up a calf etc.), education, sexual enjoyment (frgad), and gold. Saturn is Karaka for lead, zine, black metals, inferior grains, dead relatives, fools, servants, mean women, salable goods (quq%), servants, poor people and self restraint. (Ztet apart from meaning self rest- raint also means investing with sacred thread which is in vogue to give “‘second birth” to Brahmins). ae: afagiast aatg a aA: | ge anad ara: aeaag aerate: new andy gal ata: aes g TATaT: | aRicnegenfargt ug: Sgr arfas neu ## Page 90 86 Saravali 14-15. PLANETARY PLACES : The Sun rules Kalinga (a Coromandel district), the Moon Yavana (Greek, Mohamme- dan or European countries), Venus plain river banks, Jupiter Sindhu (Indus), Mercury Magadha (southern part of Bihar), Saturn Saurashtra (Gujrat), Mars Ujjain and the nodes i.e. Rahu and Ketu Dravida country (ic. five tribes: Dravida, Karnataka, Goorjara, Maharashtra and Tailenga). Notes : The reader is profitably referred to Brihat Samhita of Varaha Mihira (Ch, 16) for detailed planetary ruler- ships of countries, rivers, objects etc. Such information may be quite useful in predictive astrology and mundane astrology as well. fa searadfacfamrat areraeat TTRATEATA: ATA: Mol Thus ends the 7th chapter entitled “‘Karakadhyaya” in Kalyana Varma’s Saravali. BDAMATALAT: is i

crearfanafian: ea faaet fear aqeafar aIaTTAAAT aay BILUTYS AACATGATT EU aqraaufndea § yaracarag efireqet sfaara gadtat wade wit qaredh uu wget Helshasiananaarfiata firs eatq 1 ua wa afea fda wa: sada eign gn 1-3, A FEMALE’S MENSTRUATION; Without the know- ledge of conception time, one cannot understand the effects of the various divisions like Rasi. That is why I explain below about conception which is the cause of births of all animals. Asa result of Moon’s transit in Anupachaya Rasis and in aspect to Mars, a female obtains her menses. The Moon is water and Mars is fire; water produces blood and fire produces bile, When bile is enraged by blood, the women gets her menstiuation. ## Page 91 Chapter 8 87 Notes : Anupachaya Rasis are the houses other than the upachayas. The former are: Ist, 2nd, 4th, Sth, 7th, 8th, 9th and 12th while the latter are 3rd, 6th, 10th and 11th. The Moon in Anupachya house and in aspect to Mars while in transit can cause attainment of puberty or the regular monthly course toa female. The Moon in upachaya should be aspected by Jupiter so that the intercourse at that time leads to fruition of conception. Please see Horasara, p. 41 for more relevant information. va aquafa wit aaea fafeata wfad aq! grades fan sfama aid vet yn STAAAAT ATASSAT JIU FEhAcaarat t qat wife oat falas: yadeuy we ge ee qeradt ag fae aataq) uegeam waar vata qa aaa wel caress arsed: garfefa: Ga: 1 ea: eaqg carat wegft Feared gafa: ue 4-1. The menstruation so caused makes the female capable of conception. If the Moon is in upachaya (i. e. 3, 6, 10 and 11), it makes the menses defunct for conception. However, if the Moon in upachaya is aspected by Jupiter or her friends, or especially Venus, the woman affectionately cohabits with the male. If the Moon is aspected by Mars, the female unites with a person other than husband. The Sun if aspecting the Moon indicates a king while Saturn aspecting “denotes a servant. Similar inferences should be made if the Moon is aspected by malefics only, without aspect of benefics. If the Moon is aspected by malefics like Mars, then the female gives up her home and becomes a prostitute. Notes : If the Moon is in upachaya but without the aspect of Jupiter, the monthly course at that time does not promote the chance of conception. The other conditions mentioned in these slokas relate to planetary positions at the time of a girl's attaining puberty. (These should not be over-enthusiastically applied to one’s regular menses, for some planet or other possibly ## Page 92 88 Saravalt may lend aspect to the Moon, many times when the female gets her monthly course.) The first menses has great bearing on the future of her married life and in olden days (even now in many parts of the country), Ritu Jataka, is cast for the time of puberty. If in the Ritu Jataka. the Moon being aspected by Venus or Mars or Saturn and so on, varius results as attri- buted will come to pass. Similarly, there are specific effects for a girl's attaining puberty on a particular week day, Nakshatra, Karana, Yoga, Tithi, in a particular ascendant and in particular lunar month, For example, puberty occurring while Bharani star rules causes abortions, immorality, barrenness etc. It is inauspicious at the time of Sun-rise, twilights, eclipses, Full Moon days Sun-set, New Moon day,solar ingressions etc. In Aries Ascendant, she becomes adulterous. Similarly in Scorpio Ascendant. Pisces rising bestows a number of children. Such useful information can be elicited from the various classics like Muhurta Darpana, Jyotisha Ratna-mala etc. favaramt faawangra gafa aa® aeqt aaeigearat ovate = aartea ic measguga = mlenag waqureaq! ated ated: get areearaaenatfireremag ue aa gaisgafea: wafaefrarfaat faacate: t mafara « favafa | dat qusitfwaat: u go 8-10. The 7th house from Lagna at the time of copulation indicates the disposition of the couple. If there is a malefic’s aspect to the Lagna at the time of copulation, the couple unites angrily and with quarrel. Should it be benefic’s aspect, then the sexual enjoyment will be (pleasing) as enumerated by Vatsya- yana Maharshi. If there be both malefic and benefic aspects on the 7ih, the sexual act is mixed in nature. According to one’s past deeds, to ripe its fruits, the semen enters the womb and conception ensues. Notes : The author gives tips to choose a proper time for sexual intercourse, so that it confers happiness. Benific’s aspect to the 7th house from the ascendant prevailing at that time ## Page 93 Chapter 8 89 leads to a happy sexual act while a malefic’s aspect does not, Benefic’s aspect to such Lagna causes conception while mixed aspect makes it both unhappy and happy. According to one’s past deeds, at the destined moment, the semen enters the womb of a female and conception ensues, so that the soul which already Formed part of the semen, reaps the results in its current birth. Sram tfagat aft a: eats gadat goraedt mar aat wdaaat wafer n gu yarateniate: eisteaafead: gist ary edizarenses acafa wer awat waft u ez 11-12. OCCURRENCE OF PREGNANCY : If the transit Sun and Venus be in upachaya Rasis (3, 6, 10 and 11th), with strength, with reference to the male partner’s nativity and occupy even Navamsas, there is scope of pregnancy to be caused by the particular intercourse. Similar effects follow if strong ‘Moon and strong Mars be in upachaya Rasis in transit with reference to the female’s horocope and be in even Navamsas. Alternatively, Venus, Sun, Mars and Moon should be in upa- chaya houses in own Amsas or Jupiter be in Lagna, Sth or 9th with strength to cause pregnancy. Notes: In the transit Rasi chart, the Sun and Venus should be in 3rd, 6th, 10th or 11th from his natal ascendant and should occupy even Navamsas, like Taurus, Cancer, Virgo etc. Such an intercourse will lead to conception. Similarly, Mars and the Moon should be in Upachaya Rasi and in even Navamsa for a female. The third and fourth conditions are simple. It is worthwhile noting what Varaha Mihira denotes in his Brihat Samhita about coition, in the context of obtaining children : The woman should bathe on the fourth day of menses with the herbs mentioned (in Ch. XLVI ibid) and the hymns cited (in slokas 55-70 ibid) should be recited. After this, she should have a union with her loving husband to get a male child in even nights, or to get a female child in odd nights. If it is more distant even nights (before the 16th night), it leads to birth of longliving, handsome and happy son. So to say, if the ## Page 94 90 Saravali Adhana is, for example, in the 6th, 8th, 10th night etc. it leads to acquisition ofa male issue while an intercourse on the Sth, 7th, 9th night etc. promotes the birth of female child. The man should have sexual union when angles and trines are benefic- occupied, when the ascendant/Moon are with benefics and when malefics are in 3, 6 and 11th houses and when there are planetary indications to ensure obtainment of progeny. Curious reader may consult Brihat Samhita for fuller in- structions on this count. Then, Balabhadra inhis Hora Ratna observes on our present sloka of Saravali thus: The Sun in Upachaya houses (3, 6,10 or 11) promotes the masculine vigour of a preson while Venus so positioned strengthens his virility. Fora male, the Sun's strength is essential. Mars rules blood which produces menses in a woman. The Moon’s potence is essential for a woman and hence she should have these in Upachayas. Suka Jataka adds that the Sun and Venus should be in their Navamas while in Upachaya for a male. And Mars and Moon should be in their Navamsas for a female. In both cases, Upachaya Rasi positions are necessary. fagrea oo aataY aigeuaerad nate atentfafa: eadtderaeagan Freer: cara ut 3 13. DISPOSITION OF FOETUS : The child in the womb will be according to the mental disposition of the couple and their desires and according to Tridoshas (bile, phlegm and wind) prevailing. Notes : According to Sastras, the woman should sexually join her husband lovingly, with a desire to beget an offspring. The couple should be well-disposed towards each other, faa faaniarrar gerafarsttawrener afera: | gaa seq dat at anit g gaatary u exw Mined gaqat afaat da: ak faadegger: 1 wart were male feaat afer gu 14-15. SEX OF THE CHILD : Should Lagna, Moon, Jupiter and the Sun be strong and be in male Rasis and male ## Page 95 Chapter 8 91 Navamsas, birth of a male child be predicted. If they are in even Rasis and even Amsas, predict female child. If strong Jupiter and Sun be in male Rasis, male child will be born. Female child should be expected if Venus, Moon and Mars are in even Rasis. Notes : From this sloka onwards, till the end of this chapter, all Lagna references should be related to Adhana (srara) unless otherwise mentioned. fage arise gael armed FU! eatgrd wearai facafaritar we a gage!t: 1 Vg Mt 16. TWIN BIRTH: If the Sun and Jupiter be in Gemini or Sagittarius in aspect to Mercury, birth of two male children be predicted. Two female children will be born if Venus, Mars and the Moon be in Pisces or Virgo in aspect Mercury. area gaat faa® arisat: geasendl waft) att fagner act deter atead fead arsft ni go 17. MALE BIRTH : If Saturn is in odd house other than Lagna, a male child will be born. Such yogasand strengths at the time of Adhana should be properly assessed to predict birth of male or female child. seara = trast | faeeinat— fartheta) segucfagat at geet afeeit das sea: ues it craft am: aay qa aedtedt a fran aaa mica oaeitet ogfafa: aarfaee: u eu simanciindedt sg 0d galt Hee: ae® faqraait Regan: fearfeecet arn zou 18-20. BIRTH OF HERMAPHRODITE : Birth of a hermaphrodite should be declared if the Sun and the Moon be in odd Rasis and be in mutual aspect, or if Mercury and Saturn be in mutual aspect from odd Rasis, or if Mars aspects the Sun who is in an even Rasi, or if the Moon is in Lagna in odd Rasi. ‘These are the views of sages. If Mars aspects Mercury in odd Rasi and simultaneously the Moon in even Rasi, same effect ## Page 96 92 Saravali follows. Alternatively if Lagna, Moon and Mercury be in odd Rasi and odd Navamsa and aspected by Venus and Saturn, eunuch birth is indicated. war anerfama aed a frdifina anger aaaaat aged fagd aifead fra nae n Terit afafranfanh = qeandteaarayg | few? ar afag satq eitgeawaa nu Qu 21-22. ONE MALE CHILD AND ONE FEMALE CHILD TO BE BORN : Should Lagna and Moon be in even Rasis and be aspected by a strong planet, then there are twins in the womb (one male child and one female child). Similar results follow if the Moon and Venus are in even Rasis while Jupiter, Mars, Mercury and Lagna be in odd Rasis or common signs and be strong. fardtetragaary very fara @ oeaeitegga | faaait weet dt gest faaahd cag nz fandtrinagaary set far a caaeitegga t wait g owe geara fafa awn vn frat ageamary aett frat @ Teaetegga: | faaainersa gat geafiad cat TAU AU eraiaineaa faenrged a gafearra: | qaafa firfiregaaa: weafaad wat WAN Rg 23-26. BIRTH OF TRIPLETS : The following yogas pervailing at the time of Adhana lead to births of triplets : (@) Mercury remaining in Gemini Navamsa aspecting a planet who also falls in common Navamsa (b) Mercury remaining in Gemini Navamsa aspecting a common sign which ascends (c) Mercury in Virgo Navamsa aspecting a planet falling in common Navamsa (d) Mercury in Virgo Navamsa aspecting acommon sign which ascends (ce) Mercury in Gemini Amsa aspecting a planet in Gemini Amsa or Sagittarius Amsa (f) Mercury in Gemini Navamsa aspecting the Lagna which falls in Gemini Navamsa or Sagittarius Navamsa, (g) Mercury in 7th aspecting a planet in Kanya or Mina Navamsa or aspecting ## Page 97 Chapter 8 93 such Lagna Navamsa. Combinations (a) and (b) lead to birth of triplets-one female and two males. Combinations (c) and (d) cause birth of triplets consisting of two females and one male. Combinations at (e) and (f) cause three male children while the ones at (g) indicate three female children. faad ararfaadt gaat afi fraat a) mraattetfaqedt faadarg stadt aad: 0 ou 27. MOTHER, FATHER, ETC. : If births take place in day time Venus indicates mother while the Sun indicates father. In the case of nights the Moon and Saturn respectively play these roles. Similarly the Moon denotes mother’s sister and Saturn paternal uncle for day time births while Venus and the Sun take over these portfolios respectively in the case of night births. suatiganetna: fag: fagerer Gaz: Wea: maafiiard: aageise agar Agnes 28. EFFECTS OF SUCH PLANETS : If the planets deno- ting father and paternal uncle are in odd Bhavas, their well- being is assured. If the planets denoting mother and maternal aunt are in even Bhavas, their well being is to be predicted. adearararfeg mieq wat AR saa wag afaasaararfeacadaaaran: 28 arascay aq qCUT at a AAM aaiten: 1 wart eax age: cesfaa cet caf mi: W300 garitacfaafratiegataaitggarieear: t Rraqaa: eqtaiier guisga fara gen 29-31. PROCESS OF GROWTH OF EMBRYO AND LORDS THERE OF : The embryo in the womb improves as under : First month coagulated blood, second month-mass of flesh, third month-limbs, fourth month-bones, fifth month-skin, sixth month-hair, seventh month-movements, eighth month- feeling of hunger and thirst, ninth month-excitement and tenth month-riped like a fruit and ready for coming out of the ## Page 98 94 Saravali womb. These ten months are ruled respectively by Venus, Mars, Jupiter, the Sun, the Moon, Saturn, Mercury, lord of Nisheka lagna, the Moon and the Sun. The dispositions of these lords indicate good or bad of the respective processes. Notes : Curious readers may refer to Horasara, P. 47 for relevant information. Balabhadra quotes Parasara as under in this context : The semen sprinkled in the womb coagulates in the first month. In the second month it becomesan embryo and assumes the form of a bubble on water and the sex of the child forms viz. male, female or eunuch. In the third month it transforms into a sprout. In the fourth month, the limbs become prominent (well grown) and the bearing woman develops courage if it is a male child, assumes timidity if it is a female child and a mixed disposi- tion if it is a neuter. And the child in the womb also reflects such dispositions, (Mark the discerning scientific approach of our sages made thousands of years ago, which may bea news to even the modern medical scientists !) In the 5th month, blood strengthens in the child’s body. Bones, hair, nails etc. are added in the sixth month. During the 7th month, strength and comp- lexion improves; limbs assume fullness, the child covers the holes of its ears etc. develops emotions, has a reminiscence of its previous birth and finds ways and means for Relief. In the 8th month, sound, touch, feeling, etc. occur to the child, and it develops purity of blood and movements in the womb. Then in the 9th or the 10th month, delivery takes place. BerTaRe aca caearfas cafes aw: 1 agg at Rguiitat agar az maar frame faced cat ofrcaat aayanasaaeat adtfint ar cafe mi: nag 32-33 MISCARRIAGE : Shoulda planet be affected by celestial portents or defeat by malefic, at the time of inter- course, miscarriage may take place in the month ruled by the planct concerned. The ascendant ruling at the time of inter- course can also become cause of miscarriage; if Saturn and ## Page 99 Chapter 8 95 Mars bein the said ascendant, or the Moon be ina house of Mars or Saturn, the results mentioned will come to pass. @iegga: ahafeantaarndargaedat qafeaataara: gat a wait fathead cam u avn 34. COMFORTABLE CARRYING: Should the Adhana ascendant be occupied Moon or should there be benfics in the Sth, 9th, 7th, 2nd, 10th, 4th and malefics relegated to 3rd and Ith aspected by the Sun, the carrying female is safe. Raa: garam at guqta aTaa) aha egreqiadadtat aaafgarary yu semeana: 1a: AeaTaaferass ATT FATA I saafeaasee oat eftoiedt What 3g santise afafa si orate atfga aaat eat faaa afeeraat ge qagaraz®u go waraga: atfaaadt ar faqea mis) @ruae fafas faad wi: ag sarc fagena acfuaa fosaass aot eicth win ag faut omangadd srean zen wa efadgad atiaieat ar aiisrar faa eaaaaded: = aidenta | ateamgresé: 11 vo 1. sufaa <fagat avant at ee fafaraert adea wafa Ae Teaaa: ae TAIT ve 35-41. ADVERSITIES TO THE PREGNANT WOMAN : If.at the time of Adhana, the Sun and the Moon are hemmed between two malefics while the ascendant has no benefic aspect, the female concerned dies. The same effect prevails if the said ascendant and the 7th are occupied by malefics and be without benefic aspect or if the said ascendant is occupied by Saturn and weak Moon aspected by Mars. Again similar effects shall come to pass if weak Moon and the Sun are in 12th, Mars in 4th while Venus is between two malefics. Both the child in the womb and its mother leave this world if malefics occupy the 4th from the said ascendant or from the Moon while Mars is ## Page 100 96 Saravali in the 7thor Lagoa. The same result follows if Mars is in 4th, Sun in 12th and the Moon be decreasing and be with malefic aspect. Ifthe Sun is in Lagna while the Moon is weak or if Mars is in Lagna while malefics are in 12th and 2nd with- out benefics’ aspect, death occurs of the mother along with child. The Sun in the 7th at Adhana while Mars is in Lagna, takes away the child along with its mother through instru- ments. Notes : Please see the folowing addition causing death of the carrying woman : If the 12th house from Adhana Lagna has malefics, according to Garga, the female dies before deli- very. Should the Sun and weak Moon be in the 12th, Venus hemmed between malefics while Mars occupies the 4th, the female soon quits the world. Malefics in the 4th from Lagna or the Moon in Adhana chart causes the same effect. Should the 2nd and 12th be aspected by malefics while weak Moon or Mars or the Sun is in the 12th, the woman passes away prior to her begetting an issue. The Sun and the Moon connected only with malefics may also lead to the same conclusion. afafedagegatesse a faada mds maifaqaageaeded: «9 gvat wT: eR anf qata ecitai Agee saa aatsaay | aranfareanrafacreratrtfa faratseart ween 42-43, PROGRESS OF PREGNANCY : Should there be aspects from Mercury, Jupiter, Venus or the Sun to the Lagna, the process of pregnancy goes on well. The embryo develops according to the state of the lords of various months (in transit). In the third month, the pregnant woman develops tastes to eat various things according to the disposition of the various monthly lords andLagna Lord and the yogas caused to them. Notes : The embryo in te womb develops according to the planetary transits. If in the 3rd month, the ruler of the month Jupiter gets adverse influences, its transformation into a sprout is affected and the embryo may not sustain. Mis- carriage may follow. If Saturn is afflicted in the 6th month, ## Page 101 Chapter 8 97 deformity of limbs will result. Similar infereaces may be made as per the transits and months. The pregnant woman’s taste for eating will vary accord- ing to various monthly lords. For planetary tastes, see sloka 15, Ch. 4, infra. framera areas” aaisgfrdaet ao are Garant a feacerfarde® eargarad arequanfaa & vee watatt oo atotrait aaa: squat feature art gut art warn vyn 44-45. TIME OF DELIVERY : If at the time of Nisheka (.e.Adbana) the Sun is in a movable sign, delivery takes place in the 10th month, if he is in a fixed sign, delivery in 11th month is indicated and in a dual sign it is in 12th month. If a movable Rasi ascends at Adhana, delivery takes place in, 10th month, a fixed Rasi 11th month and dual Rasi 12th month. Notes: In sloka 45, Rasi may be construed to be Adhana Lagna or Adhana Chandra Lagna; whichever is stronger prevails. The duration of pregnancy is nine solar months or ten junar months. A solar month is 30 days 26 gh 17 vighatis 32 tatparas and 30 vitatparas. (Sixty units of the latter make one former.) A lunar revolution takes 27.32 days. The birth chart can be correlated to coneeption chart, as per the details given in the Appendix of my English translation of Nashta Jataka. The Sun or the Moon or the Lagna—all relating to Adhana if be ina movable Rasi, delivery takes place in 10th month; ina fixed Rasi 11th month and ina dual Rasi 12th month, The Adhana Lagna lord in similar Rasi also leads to same effect. Suka Jataka, however, states that delivery will be in 9th or 10th or llth month according to Adhana Lagna being movable, fixed or dual siga. After knowing the possible month, the number of days will depend on the Horary Moon or Horary Lagna (or Adhana), Should it be, say, 12° of a sign, delivery will be on the 12th day of the particular month, ## Page 102 98 Saravali Also, please see Horasara, page 49 regarding possibile delivery period. mninaafaard aremrfenomatatsareay | marissa ad aeafea Sfaaraat: nu xg mariana: aaad areca atl aenaarasd = « adei ana aT oO 46-47, The matter of delivery can be guessed through the Vargas of Nisheka Lagna. The natal Moon can be in the 10th from Adhana Moon. This view is held by many Acharyas. According to Badarayana, the natal ascendant will bein the 7th from Adhana Lagna and natal Moon will be in the 7th from Adhana Moon. Since there are several views on this, Texplain below (in the next sloka) a view which is acceptable to all. Notes : Whatever Rasiis descendent in Nisheka chart will be the natal ascendant and whichever Rasi is the 7th from the Adhana Moon will be natal Moon. Alternatively, the natal ascendant or the natal descendant will correspond to the Moon at conception. Or the natal Moon will be over conception ascendant or descendant, If the Moon be waxing at birth, it will be over conceptional ascendant and if the natal Moon is waning it will be concep- tion descendant. The conceptional chart should be worked for the place where the mother lived at the time of conception. The number of the days the child spent inthe mother’s womb can be worked out as under : (a) It is less than 273 days if the Moon is waxing at birth and be in the visible half (i. e. between 180 deg-360 deg from the ascendental cusp.) (b) It is above 273 days if the Moon is waxing at birth and be in the invisible half (Lagna to 180 deg). (c) It is above 273 days if the Moon is decreasing at birth and bein the visible half. (d) It is less than 273 days if the Moon is decreasing at birth and be in the invisible half. ## Page 103 Chapter 8 99 afery granu watera feaat frarara: aaeaet sad aden anata oat: west 48. VIEW ACCEPTABLE TO ALL ABOUT NATAL MOON: Note the Dwadasamsa of the Moon at the time of Adhana. When Moon is so many signs away from her Adhana position (ina month when delivery is normally possible) deli- very will take place. Notes : In horary chart or in conception chart, note the stronger of the Moon and ascendant. Then find out in which dvadasamsa it is. If the Moon comes into such dvadasa- msa in appropriate month, delivery can take place, Let us assume that the Moon is in Leo in a query chart in 19 deg. It isin the 8th Dvadasamsa in Pisces. When the Moon transits pisces in the month concerned, delivery will take place. Prithuyasas gives some more rules. Please see Horasara Page 50. wer aasaTin Tasat aan afe fae: 1 adaia afacieata: careafatt faq uve 49, BELATED DELIVERY (PREGNANCY): Should a navamsa of Saturn rule the Nisheka Lagna and Saturn be in the 7th, the delivery takes place after three years. If Cancer be the Navamsa Lagna with the Moon in the 7th (from Rasi lagna) delivery occurs after twelve years. Notes: As per tne first part of the sloka, Saturn should occupy the 7th bhava from the ascendant while Capricorn Navamsa or Aquarius Navamsa be in Lagna. Then, the sexual act does not promote conception for 3 years to eome. Similarly if Cancer be the Lagna Navamsa while the Moon occupies the 7th from Lagna, the conception is delayed for 12 years. Some translators interpret this sloka as well as the identical ones from Brihat Jataka and Samudra Jataka ina different way, as if the child remains in the womb for 3 years or 12 years as the case may be. arenfaafzaataraa: agate eaferrat a: | arargarerrary area} faaqeq uaat nyo} ## Page 104 100 Saravali 50. FRACTION OF DAY OR NIGHT FOR DELIVERY ; According to Nisheka Lagna being a day sign or night sign, delivery will be after so much of fraction of night or day having passed. Notes :. Tatkalika Lagna in astrological parlance also means Prasna Lagna. Hence wherever Tatkalika Lagna is translated in this chapter as Nisheka Lagna can additionally mean Prasna Lagna. Such rules may also be horarily applied to. Now coming to the sloka proper, the time of delivery during night or day can thus be guessed. If day sign rises at the time of query (or in Nisheka), birth will be in night time. Ifnight sign isin Lagna at query (or in Nishcka) then birth should be declared in day time. Suppose the 10th degree ofa day sign ison the ascendant; it is one third of Lagna. So, the birth should be after one third of night is over. This clue can be used in working out alost horoscope or rectification of birth time through Prasna. Day signs are : Leo, Virgo, Libra, Scorpio, Aquarius and Pisces. Night signs are; Aries, Taurus, Gemini, Cancer, Sagittarius and Capricorn. The Moon’s transit as arrived at, as per previous sloka, may lead lo the knowledge of birth time as instructed in our present verse. gaat feaafamorafa aad atari yeaa saa: cafgrnerggdaradaaiq 1 xe gare sad osafamidt gfifiad sears oraafafgd @ fate faferaden afwast: 0 42. 51-52. Thus should be understood the possible time of birth in day or night and the Lagna at birth. In similar manner, the difference between sunrise and birth, i.e. natal ascendant, and day (week day), fortnight, Muhurta month etc. should be guessed. Such details relating to birth should first be ascer- tained and then predictions should be issued with reference to nativity by astrologers. earat carat ciate tage att geet gaatfeeqi sear: waa wT KRU ## Page 105 Chapter 8 101 araadteacet vfanfaat ggzet gta: t aaafaarasia aur aatsqar dsaemfa nye squMaanasent ard aafaaraafa gla: qaeaaa wismeguest armat ama Wy 53-55. YOGAS FOR EYE DEFECTS : Ifat the time of Adhana (or at birth), the Sun and Moon are in Leo identical with Lagna, the child born will be blind; there should be aspect of Mars and Saturn on Leo. A bubble on the eye should be predicted if Marsand Mercury aspect the said Sun and Moon in Leo Lagna. I shall farther explain yogas affecting the eyes. Should the 12th be occupied by waning Moon, left eye is destroyed and if by the Sun, it is the right eye. If, how- ever, benefics aspect (the said 12th and the Sun/Moon), then by (suitable) efforts, the eye can be repaired. Notes : Normally th: Sun or Moon in the 12th or 2nd from Lagma, causes eye defects. If Cancer rises and the Sun be there, one can find floral mark in the native’s eye. wey gaan: aff at wiaatecfage? 1 qe: diedget ard wraat aafe yeu 56. YOGAS FOR DUMBNESS : If malefics are in Rasi Sandhi aud the Moon is in Taurus aspected by Mars, Saturn and the Sun, the native born will be dumb. If however there is benefic’s aspect, the person speaks latter on. aig ufsafag avait 7 atafatiera a as: 1 garanurmdedt afavitet afe aara: earg yo 57. DULLWITTED AND TEETHED : If malefic planets are in Rasi Sandhis (je. at the junctions of Rasis) while there is no benefic aspect on the Moon, the native born is dullwitted. Should Saturn and Mars be in a navamsa of Mercury, the birth > is with teeth. aha fartadet ataredangdafagta: 1 faqureaiagedt atisfearariget wafa Ta: 1 xs 1 58. PECULIAR BIRTH ; Should Mercury be in the Sth or the 9th from the ascendant while all other planets are devoid of strength, the child has 2 faces, 4 hands and 4 legs. ## Page 106 i02 Saravali aMARt AREA aA caaralfcfag ee | ufafa fast stata asnfeectsa ar Rem: 1 Ye 59. SHORT STATURE : If the last portion of Capricorn rises with aspect from Saturn and the luminaries (ie. the Sun and the Moon), the native is short-statured. The same effect prevails if the Moon is in Cancer identical with ascendant and aspected by Mars and Saturn. Hietad a et qartear fale: gary wafer Ty arar xafa ata: ateaugdtfanar: aa gow 60. LAME BY BIRTH : If Pisces rises at birth with aspect from Mars, Saturn and the Moon, the child born is lame. If there is a benefic's aspect to the said combination, then relief can be expected after making efforts. Sager Zemrenfeamasgiea AEC: | fafafgarge: Fivatdafe wi eet 61. BIRTH WITHOUT HEAD, LEGS AND HANDS : Should Mars be in the ascendant and fallin the ascendental decanate or a trinal decanate receiving the aspect of malefics while benefics are devoid of strength, the child in the womb develops no head, no legs and no hands respectively. Notes : If Mars is in the first decanate of Lagna in aspect to malefics while benefics have no strength, the child will not have its head, (it may have peculiar head). Similary, the second decaaate position of Mars in Ligna (i.e. Mars falling in the 5th.from Drekkana Lagaa) with other conditions as laid down above, the child does not have legs. Again if Mars falls in the 9th from Drekkana Lagna with other rcquirements being ful- filled as above, the child does not have hands. qararafaad safeanasit mate 1 ara ated safafafed aafr farerq neu 62, Whatever is stated in this chapter, should be suitably applied to natal ascendant if applicable. And the rules stated elsewhere in regard to nativity may be used with reference to Adhana (sara) also if need be. ## Page 107 Chapter 9 103 Notes : Thus, the rules in astrology relating Horary, Adhana and nativities should be suitably interchanged with wisdom and sense. eft searqadfactrarat areracat arerareqa: wee Hs It ‘Thus ends the 8th chapter entitled “Adhanadhyaya” in. Saravali of Kalyana Varma. ar sea faurarera: 8

area fg ated sgfaeraed fauiaraecy | afenq ogaftar® = osrareard = saearfizu gu 1. To know the time of delivery, I have explained the Adhana chapter. Now I explain the natal chapter as below. wrafad faa qeat sadtseadtad geet: 1 gadtad @ ged: gaged atadtserat wee: 3 2. KIND OF DELIVERY : If natal Lagna is in Sirshodaya Rasi, birth is with head foremost, anda Prishtodaya Rasi at birth indicates birth with legs foremost. The birth is with hands in such a position ifan Ubhayodaya Rasi ascends. Should Lagna enjoy benefic aspect, delivery would have been comfor- table; otherwise difficult. Notes : Sirshodaya signs are: the signs that ascend with head first. These are : Gemini, Leo, Virgo, Libra, Scorpio and - Aquarius, Prishtodaya signs are : Aries, Taurus, Cancer, Sagi- ttarius and Capricorn. The sign Pisces is called Ubhayodaya Rasi. Ifa Seershodaya Rasi (like Leo) rises, the child has come out of the womb with its head first. Should a Prishtodaya Rasi (like Cancer) be ascending, the child comes out with legs first. It comes out with hands first if Pisces be the Lagna. ## Page 108 104 Saravali If the Moon be with malefics or connected with them, the delivery would cause difficulty to the mother. Benefics associated with Lagna makes it easy while malefics indicate difficulty experienced by mother. According to Maniththacharya, if the lords of Lagna and Lagna Navamsa are retrograde at birth, the child birth is with great labour trouble. See (Hora Ratna Ch. 1). aanimaenaa saat fa: aatsa gaataty | faongeit seit fearerae aat cage gu eagenait «= wR eaygseafenenfeara fagaranganaeaagat owaq saan 3-4, PLACE OF DELIVERY : The place of delivery will correspond to the Rasi Lagna or Navamsa Lagna at birth. If it is a dual Rasi or Navamsa, delivery will be on the way. A fixed Rasi/Amsa indicates delivery in one’s own place. Should the Navamsa be of the same Rasi the delivery is in one’s own house; otherwise it is otherwise. The delivery will be in the house of father or mother according to the indicator concer ned being strong. marawmig a afadtarind: ales Aaa aE aeEAT TAT Agee UY afaaar a at seca atert gat gat: | waa oafaa fear wqamanatea aang ata go caggna afaft afaadara meme qasia® astgigt aff ue i 5-7. If benefic planets are in fall, then the birth is in an enclosed place, under a tree or on the banks of a river. Should all planets be together and not aspect Lagna or the Moon, then the birth is in a thick forest. If a watery signison the ascendant, © and aspected by Full Moon froma watery sign being 4th or 10th, (72) birth is in water (i.e. in river etc.) and similar results be predicted if Lagna and 4th are occupied by benefics, and Full Moon is in watery sign or in own house. ## Page 109 Chapter 9 105 qafangeaizaa alt atft | caazl wafe saa: eta aafa aaa: ag alae: vas saafaeat mtstear® gafaat saa: vat tart aie? aa aT NE arequaraat faftaagi gar avian efatfa® saat frevafratg ate go qafaa Mavtaae geegareai wactaatn amsags? feaafgea aad aenaafea gag ee Ul 8-11 If Scorpio or Cancer ascends with Saturn and is aspected by Moon, birth is ina deep place. This view is held by Yavanas and Maniththa. Should Saturn be in watery Rasi rising and aspected by Mercury, birth isin playground. If the planet aspecting is the Sun, it is temple and the Moon aspeci- ting indicates barren lands. Should an “Aranya Rasi” (for example Leo) be on the Lagna, the birth is in hills, forest, fortress etc. Should a human Rasi be ascending, and is aspected by Mars, it is burial ground, if by Mercury sculp- ture home and if by the Sun cow-shed, royal palace or temple. If the aspect is from Venus and Mercury, it indicates pleasing location and if from Venus and Jupiter it is brahmins’ place or where sacred rites are performed. eated cat a fefragi fas 72 saa: wranftsara «= agdamafead: dled: neg 12. DELIVERY HOME DESCRIBED : Should Jupiter be exalted in 10th (i.e. Lagna being Libra), delivery is ina 2, 3, or 4 storeyed building. If benefic planets are in Saturn’s Rasi_ or Navamsa, coinciding with the 4th or 10th, the delivery is in a veranda or balcony. at at cat Rang gaifeg dfeaat gefaati wiaig fed amg wafe aga: neg 13. To know the direction of the delivery room, proceed thus : One of the dual signs ascending denotes the quarter (of the direction) in which the room is situated. The other signs from Aries on indicate the directions of the room, ## Page 110 106 Saravali Notes : The first two signs preceding the first dual sign indicate the east. The first dual sign, Gemini, denotes south- cast. The next dual signs is Virgo denoting south-west. The signs Cancer and Leo denote the south. The third dual sign represents north-west while the signs Libra-Scorpio hint at west. The last dual signs Pisces repersents north-east while Capricorn and Aquarius indicate the north. Each sign ascending accor- dingly indicate the direction or quarter in which the delivery room is located. For example, Virgo rising denotes south- western room. Similarly other signs. fanmfancsateig aig — aeatert wa qngaaaaea yg fat faatt wn wen 14, Should there be a planet (which is strong) in the angle of a sign, the direction represented by that (latter) sign will prevail. If Sagittarius ascends with strength, it is 3- storeyed building while Capricorn denotes a spacious house. Notes : Suppose there is astrong planet in the angle of Arties i.e. in Cancer, the direction represented by Aries, i.e. east will denote the direction of delivery room. If Sagittarius with strength ascends, the building has 3 storeys while strong Capri- corn indicates a spacious house. The last rules relating to Sagi- ttarius and Capricorn may always not be found true in a uni- versal manner. feiad yqga a a ata aa gH farat ofequintssy | wi ad a aghafeogd ga a shat waggafeatounenad wu KU 15, HOUSE OF DELIVERY : If Venus is strong at birth, itis anew and painted house. Jupiter in strength denotes a strong house while Mars indicates a burnt house. The Sun stands for house constructed of wood. It is a new house if the Moon is strong. Saturn in strength indicates an old house. aay Beary at feaarsrrg aettatg | wanugdatt: sfatentieereitar | yr eg ## Page 111 Chapter § 107 Faraareguanalafagrereadenveary | fag a wreacahgaqerdiaiagadng ut go tl 16-17. The direction of the planet occupying an angle denotes the direction of entry for the lying-in-chamber. The planet thatis conjunct with the planet denoting house of birth indicates the direction in whieh another house related to deli- very is located. The Sun indicates temples, the Moon watery places, Mars fire houses, Jupiter treasury, Venus parks etc., Saturn filthy corner; and Mercury bed room etc. Notes: The planet denoting the house of birth is discussed in sloka 15 supra. Suppose the Sun is the strongest at birth, place of delivery should be deemed to be wooden house. If another planet isin the company of the Sun, the former relates to another house connected with delivery. weaftafriacagafagraatts aa fara areata a faarg guefesatfa gaa: gs sreafegefead fiat caara araifart mimgincaat seged mat | amen waged at fad faaaed a feqicufag ai gefarareeat: otar: Wg SH aT: NAT: 11 Jo Ww 18-20. POSITION OF COT : Now explained is the situation of the cot on which the delivery took place. The 3rd, 6th, 9th and 12th indicate the four legs of cot. ‘The first two relate to southern side legs and the other two denote the nor- thera side legs. If the ascendant is aspected by a benefic, the kind of cloth relating to that benefic was spread on the delivery cot, The ascendant leads to know the direction in which the mother was having her head. The depression in the cot corres- ponds to the common sign occupied by malefics. ataet quad aasaaat g& faa ari afaamfiaacgaangarar: «after dat ween ngfeaamrdgacadigeaat aareay | Ramen gaaateatat giairg wu azn ## Page 112 108 Saravali mifaeqtgt osemdat: «| qtlanfaara | feetdeaneqt adafed: aatanaardy 0 33 21-23. DELIVERY ON GROUND AND NUMBER OF ATTENDANTS : If the Moon is in her debilitation sign, identical with the 4th or ascendant, the birth is on the ground (ec. not on cot, bed etc.) The number of attendants can be known by the number of planets posited between the Moon and Lagna. The number of attendants inside the chamber is known by the number of planets posited in the invisible half and the number of attendants outside the chamber will correspond to the number of planets in the visible half. If the concerned planets are benefic, the attendant ladies are with attractive features, beautiful and bedecked with ornaments. Malefics similarly indicate that such females are ugly, unfortunte and dirty. If the planets are of mixed disposition, but.with strength, the attending women are in between the said two accounts. Ail these should be accordingly understood. grawamfeera = ateaygsafead «= agaist Aaracfeafeg ada areg: peaTHTa RY aracaatgfad afadear g mad waft aa: ga qa: afat etd agg deem yu 24-25. POSITION OF LIGHT : Outof the 12 Rasis the one occupied by the Sun will indicate the portion of the delivery chamber where light is kept, If it isfixed sign, the light burns steadily, and if it is a moving sign, it is unsteady. The portion that expired in Lagna is indicative of the extent to which the wick has burnt already. The quantity of oilin the lamp will correspond to the waxing or waning state of the Moon. aaafa qa est agq sdaq ata BgaT weazamaay: = aat satfaegardafa u 2g aitsa wait wistadgasaar fegzs aq at gatcafe sed a wR URN 26-21, There were many lights (in the delivery chamber) if the Sun is aspected by Mars. Should other planets be all ## Page 113 Chapter 9 109 weak, light was obtained by burning grass. Should the Moon be in a navamsa of Saturn or be in watery navamsa or in the 4th house and be in aspect to or in the company of Saturn, deli- very was in a place of darkness. There is no doubt about this. Notes ; Since both the Sun and Mars indicate brightness, their mutual aspect suggests many lights. In sloka 27, combi- nations for birth in darkness are given: Saturn is a dark planet and hence the Moon’s connection therewith, lead to birth without lights. Watery signs are brought in the picture, Because water is not congenial for a lamp to burn. The con- juction of the Moon and Saturn in 4th (house related to mother) also causes darkness at the time of birth. Srerataary afar qeafead rake ara: 1 Agraria at ay oatat fata acu afaatenifaaat: asia argcemt: frrterwaa | aeerat ovat gaafitadteg FA Aa REN qsquaamay qriveta © arqdesé: 1 ag: feast ufsama saat atin 30 0 28-30, BIRTH OUT OF FATHER'S SIGHT : Should the ascendant be without the aspect of the Moon, the birth is be- hind the father, i.e. the father was absent from the place. If the Sun is in the 9th identical with a movable Rasi, the father was in a foreign place. The Sun in the case of day birth and Saturn in the case of hight birth, if aspected by Mars, delivery is out of father’s sight. Ifthe said Sun or Satum be ina movable sign, death of father (ina distant place) should be declared. If the Sth, 6th and 7th from the Sun are aspected or occupied by malefics, the father was under confinement. Movable, fixed and common signs here indicate confinement, respectively in foreign place, own place and on the way. wrafaatmded: mturaaia: = saat aanagatana: dha: | age fager uaz 31. DELIVERY—COMFORTABLE OR OTHERWISE : Should the 7th house and the trines be occupied by malefics, ## Page 114 110 Saravali the delivery is not without trouble. Benefics in the 10th and the 4th cause easy delivery ina large room apart from giving wealth. waafa ge: ate at a fearet Wegy) qraga at are ag af AIeaTa: FATA NI RR I qeinfrcat a gal aTasaaraigqgea | WASTAYTA: «| YATATeTAPATTATa MN 8B 32-33, BIRTHS OUT OF FATHER'S LOINS : The following lead to birth outside wedlock : (a) Moon or Lagna sans Jupiter’s aspect. (b) The luminaries being together without Jupiter’s aspect. (©) The luminaries along with malefics not receiving the aspect of Jupiter. (@) The Sun, the Moon and Jupiter simultaneously in fall while Saturn is in Lagna and Lagna, Moon and Venus not being in aspect to Jupiter. Notes : The following are additional traditional rules for illegal births = (1) The Moon in the 4th and in aspect to malefic or ini- mical planets. (2) Lords of the 3rd, 6th, 2nd and Sth occupying the ascendant. (3) Saturn in the 10th, malefics in Lagna while benefics are confined to,the 7th. (4) Mars and Venus in the 3rd while the Moon is in Lagna (5) Sun in the ascendant and Rahu in the 4th. (6) Sun and Moon in Lagna or Sun and Mars in ‘7th. (7) Lagna with Mars and Rahu while the luminaries are in the 7th. (8) No planets in angles, (9) All planets relegated to 2nd, 6th; 8th and 12th (10) Lords of Lagna and 7th in conjun- tion. (11) Lords of Lagna and 4th in exchange (which is other- wise a Raga yoga). (12) Lagna and Moon not belonging to any Varga of Jupiter. (13) The Sun, Moon and Jupiter together in Lagna while one of them is in fall. (14) Karakamsa Lagna, related to only malefics. (15) Any one group of the following prevalent at birth : (a) Sunday-Dvitiya Thithi-Swati Nakshatra (b) Wednesday-Saptami-Revati, (c) Sunday-Dvadasi-Dhanishta, Some Of these combinations do not call for literal applica tion. In this context Jupiter in the 4th or Mars aspecting Jupiter ## Page 115 Chapter 9 il or any Kendra occupied by a planet or Lagna Lord in Lagna or benefics aspecting the ascendant or Jupiter and Moon in mutual Vargas or the Sun and the Moon in exchange cancel the combi- nations for illegal birth. wat ag: wtdeacand: wargyadat arate aranzrait QT AQT AHA: uN RB¥ wary oo wrguigdta wet maga: 1 qa warray atfegaeta at gee ayn walfeaarant vast aigdd faafa cats greta feat owte: gta argee: nag 34-36. EVILS TO MOTHER: If the Moon is in the 4th or 7th along with malefics, it is evil to mother. The native’s mother dies (immediately after delivery) if there are malefics in the 7th from the Moon, and aspected by Mars, The Sun in the 10th from the Moon along with malefics indicate death of the mother. The same effect prevails if the Sun is in the Sth or 9th from Venus (??) and with Saturn’s company or aspect. If birth takes place during night time while Saturn occupies 5th or 9th from the Moon, the mother soon leaves the world. For a day birth, if Mars is the Sth or 9th from Venus and aspected by malefics, the mother dies (early). Notes : According to Jataka Sarvasva, should the Sun be in the Sth or the 9th from the Moon and be aspected {by male- fies, the mother dies carly. If Mars is inthe Sth or 9th from Venus and aspected by malefics, the paternal grand-mother dies early. aadftanin aaseana fageat arars qt gtagem = gafadt desta gu zon Fama gaat aff faa msiseat arm: 1 amt prarmentagargawradttag acu aeafa ate aan aretrggtia Treat STAT | gauagect aia gatsaat faa ae umiafaatat garcateasaasaar atars waa aaa WA afaatfra fama 1 vo i ## Page 116 ‘12 Saravali 37-40. MOTHER FORSAKING THE CHILD : If Mars and Saturn join in the Sth or the 9th from Ascandant, while the Moon is in the 7th, the child is forsaken by the mother. Jupiter’s aspect in that case bestows happiness and long life. The child given up dies if the Moon is in Lagna and Mars isin the 7th,in aspect to malefics. Mars and Saturnin 11th bring similar effects. Should a benefic aspect such combinations, the child is rescued by the respective relative. Both malefics and benefics aspecting indicate death in the hands of others. Saturn and Mars joining in the same Amsa indicate that the child will be forsaken by the mother. Mars in the 7th from the ascendant in aspect to Saturn produces similar effects. argeaaafa aleqeraeagt ga: AATad | faqsadteraed w: aaTgea aaa tt Ye II 41. RESEMBLANCE DESCRIBED ; The child acquires the qualities corresponding to the benefic’s aspects. Should the Sun be strong, it resembles the father, If the Moon be so, resemblance is that of the mother. fagramfacad oral area afeedt weg: | way msisT ae CMTAATATTA TY I 42. BIRTH WITH COIL AROUND: When Leo, Aries or Taurus rises with Mars or Saturn, there will be coil around the limb as indicated by the Navamsa Lagna Rasi. aiwafizenrt at at feat afage at! giaiaat: dteacfaafeeam yegy a tt v3 i qasagqeazes: aiat feaeieafeaar afer: | | mia featgt att ag dsaaa ve tt 43-44, COILING BY NAVEL CORD : If the Lagna falls in a decanate of Mars of Saturn, while malefics or Moon occupy Lagna, with benefics relegated to 2nd or 11th denote that the child was born with navel cord coiled around. Should the Sun be in a quadruped siga, while others with strength remain in dual (common) signs, it indicates that twins were born coiled by same navel cord. ## Page 117 Chapter 9 13 AAAAATTGETT ufdadeagarguereria | aawimeuiter: afageata aa AaeT ll xy Il agat afe aageat fear gftieaar areat | wamtfaangear gqeatssaat aarfasiaew: Il vg 11 45-46. FEATURES AND CHARACTER +: The physical appearance will correspond to the Navamsa Lagna or the strongest of planets. It may also correspond to the lord of the Navamsa occupied by the Moon. If many/are strong, appearance and complexion, will be mixed. Race, caste and country of birth should be considered while estimating features and chara- cter of a person. faagit argdaea oaeq fead) aafa agem: safe: mtd gaatsergeafia ni vo 1 41. NATURE OF THE NATIVE : Sages say that the nature of the native will correspond to (that of the lord) the Trimsamsa occupied by the Sun at birth. aemraggafted aa a alateancadfnaary | areal ageaaraiedsa: « dfaxaneaaft ys it 48. Other information must be understood according to the friendship, enmity and debilitation, exaltation or placement in between, of the planets at birth. etter afitfs aqrt arar Farad frat zal azq | qageé § fateaifa: ated: gy wafa ven 49. DEATH OF PARENTS : If weak Moon be with malefics, mother’s death takes place while the Sun being so causes father’s death. These planets indicate sickness (to the concerned parent) if aspected by both benefics and malefics. . Benefics however, cause auspiciousness (in such a case). fagafaaagfa: edteant ar excrsit qefaaga grgaterargaez: | afaaagyar gat arsft arg: fagefa ay agq WERE: AMET Yoh ## Page 118 114 Saravali 50. HAPPINESS OF PARENTS : The Moon, being bright, if be in her exaltation Rasi_ or in her own Rasi along with Jupiter and Venus in aspect to Mercury, or the Moon in Sth is capable of giving extreme auspiciousness in respect of the native’s mother. The Sun so placed proves auspicious for father. fe aearqadfacfaarat arcracat aenfeararearat aaa: 1 Thus ends the 9th chapter entitled “JANMA VIDHANADHYAYA” of Kalayana Varma’s SARAVALI. BAIShBeAT: 11 ot Chapter 10 Evils At Birth aigatanna ad fant satfeed genta aearasarra = feszteargd = naearf ne 1. NEED TO KNOW OF LONGEVITY : In the absence of knowledge of longevity, attempts to know other information are futile. So, 1 explain below Arishtas (or evils), in order to determine longevity. Me feaat: gata: gatsgia giefa: wareatar: graaag at ast faft afeed afer nu 2. STRENGTH OF MALE AND FEMALE PLANETS : Male planets are strong in odd Rasis, bright lunar half and day time. Female planets are strong in even Rasis, dark lunar half and night time. fafaafag areserer fraaafad a atts arg: | arrayed oaraget oo eara | ofettu g 3. KINDS OF EVILS : There are three kinds of evils, ex- plained by astrological expounders. These are: preordained, accidental and Yogaja (arising of planetary combinations). The third kind is dealt with below while others are explained later on, ## Page 119 Chapter 10 us agrafert aqgscenea: qaeguniaecegia | aethafrattagtegial aarat sraafa saa etl 4, LONGEVITY CURTAILED TO MINIMUM : Should Jupiter be in the 8th andin a house of Mars (i.e. Aries/Virgo rising at birth), and aspected by the Sun, the Moon, Mars and Saturn, the child dies in 3 years. Notes : For Aries, Jupiter rules the 9th and 12th while for Virgo, he rules the 4th and 7th houses. Even though he is aspected by Mars-the dispositior, Saturn-Ayushkaraka and the luminaries, his close friends, he is harmful in respect of longe- vity if in the 8th for the said ascendants. If Jupiter is in the 8th house belonging to Mars, but be without aspect to all the said 4 planets, the longevtiy may be more than 3 years, but not full. amt afaal agg soeasaegsczacssa aged aT faaia arorcaae eel aed Shaafa saa Ny 5. If Saturn is retrograde in a house of Mars while the Moon is inthe 6th, 8th or an angle, and aspect Mars, the child born lives for two years. wencignacaiga: Taiat qega: TATRA | adaafaata featg wetoster: WGN Wafearerateet wer = -agggt fantsasd a at anpaetsit AaAT ON 6-7. If Saturn joins the Sun and Moon at birth, the life span is only nine years, according to Brahmasaunda. Should Mars, the Sun and Saturn be in Taurus identical with the 8th, the native lives for one month even though Lord Yama may try to save him.? GH: ase: gage qadtfadt antes arafa at amd gard aa tasfrucu cfaafarrat gat arenfegeesr: git: aa: 1 qe: wtf afsaddaet fiers fat fue n + Some texts read wtr7% while still some read yx 7%, in place of gaay ## Page 120 116 Saravali 8-9. Even if there be a single malefic in the 8th house, owned by Venus und aspected by other malefics, the native lives for one year only inspite of the fact that he may drink nectar. If Venus is in the 12th, 6th or 8th house, owned by the Sun or the Moon, and is aspected by all benefics, the life span is six years. . wazarafa atea: asstszna feaet facmatg + waTt weqiaddagesa = areafa got Aaseratar aaarad fafafaareag wa ag Fa fest Ag wAarAary un eet 10-11. If Mercury occupies Cancer identical with 6th or 8th from ascendant and is aspected by the Moon, life is only upto 4, The efficacious Raja Yogas expounded by Yavanas may produce persons of high descent; even such children are subject to premature end, in this case. Notes : For the first rule, the ascendant should either be Aquarius or Sagittarius, so that Mercury is in 6th or 8th in Cancer. Thus, the Moon becomes the lord of the 6th for Aquarius and the lord of the 8th for Sagittarius. Her aspect on Mereury is deemed to curtail longevity to four years. In sloka 11, the author hints at the fact that even though a person may be born with powerful Rajayogas, if Arishta yogas indicating premature death are simultaneously present, the latter prevails. Of what use are Rajayogas in the face of Arishtas ? agafeaasegfaacafersgaa oat fet aragia oo acoi fafafatraca | rae eg mraedt faaeme: ortafafatretfra: ae: 1 areafa daarafa ofa a a darat waft ez 12-13. If lhe birth star is identical with the one in which Ketu? rises, the native lives only for two months. Should the 1. Ketu has been interpreted as Dhuma Ketu by some translators, ## Page 121 Chapter 10 17 Sun be in the 10th house identical with that of Mars or Saturn and aspected by strong malefic, the native faces immediate death. wa aqienrar faaerigheqararacdan: | RVI aaa: MUaT a eavfagern ue ugragseueat azarae fardtfrat wafer ara: 1 aaaafa enfa: dteafa: Sfaerarak i oyu 14-15. Should the ascendant fall in Nigala, Sarpa, Pakshi or Pasa decanate and be occupied by malefic planets, without the aspect of the decante lord concerned, the native lives upto 7 years only. If Rahu isin an angle and aspected by malefics, the longevity is only 10, while according to some, itis 16. Notes : For example, Sarpa drekkana in Pisces is the 3rd decanate, i. e. 20 degrees-30 degrees. Suppose Rahu is in 20-30 degree area of Pisces. He should be aspected by Mars, the ruler of Scorpio where the 3rd decanate falls, so that the child lives beyond 7 years of its age. Similary for other decanates. qrarfermteaed alrar: qswereqaTatee | gated nga: aa: orqieaaft wg: eg marfeaseart «= weaafasareagqraat mea | daateg oat faeaist | wfarata ul got 16-17. If malefics are angles and trines, while benefics are relegated to 6th, 8th and 12th, one born at the time of Sun rise dies at once. If the three planets, viz. the lords of Navamsa Lagna, Moon sigo and natal ascendant, are combust, the person lives just for a few years. Notes : Benefics posited in evil houses as malefics occupy Lagna, 4th, 7th, 10th, Sth or 9th, death is imminent if birth takes place at Sun rise. With the combustion by the Sun to Lords of Lagna, Navamsa Lagna and of woon sign, the longevity is highly afilicted. 1. Some say specially Saturn/Mars. ## Page 122 “18 * + Saravali ufasftdadaiaa faeadt fegeara arazentaafatesacarfadt afau es n 18. If the 6th house (from the ascendant) is occupied by the ascendant lord, death occurs in the year- corresponding to Rasi conceracd; if the occupant is the lord of rising decanate, deaith occurs in the month corresponding to the Rasi concerned and if it is lord of Navamsa Lagna, the Rasi concerned causes dealth in so many days. Notes : Suppose Virgo rises at birth and the sixth house, Aquarius, is occupied by Mercury, Lord of agna, -death occurs inthe 11th year as Aquarius is the lth Rasi of the zodiac. Death in 11 months should be expected if in the said case, sixth is occupied by the natal decanate’s lord. The native. dies in 11 days, if the said Aquarius. is occupied by thelord of Navamsa Lagna, areafa deme: aise: oradtfitet aa aga arta og astegaeg arcaftn gen 19. If Saturn is in the ascendant in aspect to malefics? longevity is only 16 days; if Saturn in the ascendant is in’ the company of malefics, death occurs ina month and if he is alone in the ascendant without malefic connections, the child lives for one year. Notes: Saturn alone in Lagna identical with Libra, Sagittarius, Capricorn, Aquarius or Pisces is not adverse for longevity. His lonely occupation in other Lagnas are pronoun- cedly harmful for longevity. According to Sage Jambunada’s Jambu Nadeeyam, one with Saturn in ascendant identical with Libra, Sagittarius, Pisces, Aquarius or Capricorn will possess attractive limbs, become a king, be learned and rule cities.and villages. atuatiwad ameq: arti: gat aimed fe dat aeiteitsarg ofterea nn yo 0 aatearcafet sail qesteznrtrfra feat aratg | aa: Rigs: AeA TSA CSHTITAT Nt BEN agaga: ag? adagetar fafatteraq | agra: waeq: srergarfamd ce all 1. Some texts read as Sun and Marsinstead of mlaefics. ## Page 123

Chapter 119 20-22.1f weak Moon is in the ascendant excepting Cancer, Taurus and Aries, and is aspected by malefics the child passes away (soon). The Moon in the 6th or 8th if aspected by male- fics, causes death in one year, while when aspected by benefics, she kills in the 8th year. Should the aspect be from both bene- fics and malefics, the life span is only 4. This should de decided according to the strength of such bodies. Notes ; Vide Jambu Nadeeyam, if weak Moon occupies the birth ascendant identical with Cancer or Aries, the native will be wealthy, and virtuous. If the Moon occupies ascendant coinciding with a human sign or centiped sign, the native will be wicked, deaf, dumb or will be stammering in speech. ater: qearszamt: qddaTA wag et: | maa Hegared af a queaa araset: 11231 ararggtanaat: wthaad a cerfegge | guaraiaardata asgsceh arsfit nevi 23-24. Should benefics be in the 6th or the 8th and be aspected or conjoined with retrograde malefic, without the aspect of (another) benefic, the child lives only for one month. If malefics are in the 12th, 2nd, 6thand 8th, without connection of benefics, the child dies in 6 or 8 months. ararfaasencat otergafenat sean weafedl acaatt | ufasfnaaed: 140 arefartees vafaat acuta facta RIAA HAAS aA TATA YA 11 AE A 25-26. If the lords of Lagna and the Moon sign are together in 6th, 8th or 12th and be combust, the child dies in the year corresponding to the Rasi.! Should the lord of the ascendant be in the 7th, defeated? by a malefic and be without a benefic’s aspect, death occurs in a month. Similar clues should be drawn from the Moon and her dispositor. 1, See notes under sloka 18 of this chapter. 2. This obviously refers to planetary war. ## Page 124 120 ‘Sarava li aa: gaefagaa: cagaeara a arf gues: | Rei fat: savaft ad wat a ate: ron atraug Fat we: aweiea gaa aferfa: 1 - arf aga vel sraea aiifa granary nest 27-28. If the Moon is conjoined with Mars and the Sun and be in the 2nd or Sth unaspected by benefics, the child doubtlessly dies in the 9th year. Sages declare that if the ascendant lord is in the 8th in aspect to all the malefics, who are with strength, the child dies in the fourth month. seafaeft: ga: cagaafedtse® wafer trait aq ufasfancea feda BEB: AReN STPACANAT TATE’ ITAA Fat Yretwata i a3g dteaagafaag srifaatd anf sora: uz0n 29-30. Ifthe lord of the Moon sign, the Sun and his son are in the 8th house, the child dies in the year correspond- ing to the Rasi concerned. Should the Moon be with malefics, be in the 12th, 8th, 6th or ascendant and be not aspected by benefics, while benefics are non-angular, the child dies at once. area gaat ora: dteqeaaat aa gbawart oat Target asryfgatisierg uaen aitt afata faa aa: aetg qegdedat wafa facfarasi gaaficddd daq uaa 31-32. If malefics are in the oriental half of the zodiac, with benefics relegated to the occidental half, birth in Scorpio Ascendant causes what is called Vajra Mushti yoga. One bora in sucha yoga does hardly live. According to Yavanas, if _ weak Moon is in Lagna while malefics are angular or in the 8th house (instant) death is caused.* 1. See notes under Sloka 18 of this chapter. 2. See notes under Sloka 20, chapter 10. ## Page 125 Chapter 10 121 Notes : The oriental half or eastern half (ie. q¢arm) in Hindu astrology is the area from the 10th bhava madhya to the 4th bhava madhya ie. second half of 10th, then the 11th bhava, 12th, Lagna. 2nd, 3rd and first half of 4th bhava. The rest of the horoscope i.e. first half of 10th, then the 9th, 8th, 7th, 6th, Sth and the second half of the 4th is called occidental half or 1% WI of the horoscope. (These two are different from visible and invisible halves of the chart). In the sloka, the ascendant is fixed as Scorpio. Hence malefics posited in the zone of Leo 2nd half through Aquarius first half and benefics posited in second half of Aquarius through first half of Leo can cause death at the very boyhood. treaatd: Wd: aeqral afeachagrerargt Wy: eed: RG TTgTTaTa naan aaageade ocaeraeat aff ara: faad saris faad tacit cferat ata: navn 33-34, One born in twilight does not live long, if the ascendant falls in lunar hora, while malefics are posited in the ead of the Rasis which are angular, along with the Moon. Should the Moon be amidst two malefis and be in the 7th, 4th or 8th, even Gods cannot save one from (instant) death. Notes : Sandhya means the junction of day and night or the night and day. If one is born at this time while the Lagna falls in the Hora of Moon (i.e, Lagna being 2nd half of an odd Rasi or the first half of an even Rasi), and while malefics with Moon are in the last portions of the Rasis occupied by them, and be angular, death is early. Individually, the Moon should not be in the 4th, 7th or 8th hemmed between two malefics for a long life. oagarand «= geteacarpafead 0 ae ateizates? «owt fart oat aa nan maga: wt: Radia: ae aa) fous guded: amen aarezeurfag nae ## Page 126 ) 122 Saravali |. 35-36, Ifthe Moon is hemmed between two malefics, | beinthe ascendant the 7th or the 8th and be in aspect to Weak benefics, (infant) death follows. Should malefics be in the . 7th and 8th and be aspected by malefics, the child dies along with its mother. If there be aspect from benefics in such a case, the mother becomes sick, (i.e. there will not be immediate death). oo) qeghard wi amt wat Fisgaty O° ear ant feat aaa a aaa uot aft afata fart wecahrearfaderat a1 ateares? ay: we: aaa Pada: acu 37-38, If the Moon be eclipsed (je. lunar eclipse operating at birth) and be in the ascendant along with malefics, while * Mars is in the 8th house, the child quits the world along with its mother. The mother dies of weapons along with the child, if it be a solar eclipse with Sun and malefics in the ascendant while ‘Mars-is in the 8th house. Should weak Moon be in the ascen- dant, and malefics be angular or in the 8th, without benefic’s aspect, death is imminent. This view is of Satyacharya, gamaise A aR EH ar fare arsfity waa Raragag shar: wren draftees: Wa: eftt crass wet mae wa aa: Ferg -Regur: uvon 39-40. The undermentioned combinations cause death soon : (a) The Sun in the 7th while Saturn or Mars is in the ascendant. (b) The Sun in the ascendant, while Saturn or Mars is in the 7th. A (c) Saturn or Mars joining the Moon and be not aspect u ed by benefics. (@) Malefics in the ascendant, 8th, 7th, 4th and 10th the Moon be decreasing in the 12th. ## Page 127 Chapter 10 103 MAPA ATTRA TAQ TTT: \ waeN TAHA: SP Ta JRA AF Age: ween wa aease at Tat afeafeaataiarg atedegecgaar: vet wera attfaar aaa: wegn 41-42. The Moon, the Sun, Saturn and Mars are capable of inflicting infant death if they are together in the ascendant, the 12th, 9th or 8th unaspected by Jupiter of the ascendant is tenanted by the Sun or the Moon while malefics are in trines or the 8th and be not aspected by. or conjoined with benefics, according to Yavanas, infant death is caused. Notes : As per the first rule, the four planets, viz, the Sun, the Moon, Mars and Saturn should join either in the ascendant or in the 8th, or inthe 12th or in the 9th to cause child mortality. If they are, however, aspected by Jupiter, the yoga stands nulified, Secondly, when the ascendant is occupied by the Sun or the Moon while malefics are in th Sth/ 9th/ 8th without relief from benefics, infant death is indicated. ga cfeaiaafedt arate at war saat eatsfe tagemt | rade | wees: ea WAeaETAEAT afarcraart sat frarae: | serine gata g ateafadtiera: ger evn 43-44. Venus joining the Sun and Saturn causes instant death. This combination doubtlessly gives death in the 9th year if aspected by Jupiter. Death in childhood occurs if the Moon is conjoined with Mars, the Sun and Saturn, provided unas- pacted by benefic planets. Notes: Should Venus join the Sun and Saturn, the child will die immediately at birth. If the combination is aspected by Jupiter, then the longevity is extended upto nine. Similarly the Moon, Mars, the Sun and Saturn in conjunction will cause child mortality, if benefics give help, this yoga does.not prevailand the child will live long, if favourable yogas are present. ## Page 128 124 Saravali wfazateazeset faaaml fanaa g wea aragat oat garg frat fareirt arra: ueun viet gayegacienfa efrergatcatgdtsa: waate faacadte fagefe a adtewaicg uven 45-46. If the Sun is aspected by Mars and Saturn in the case of a day birth, it soon leads to death of the father. The Sun joining malefics (for day birth) also indicates the same effect. The child’s father and paternal grand father will face early death if the Sun is in the ascendant along with Mars and Saturn but unrelated to Mercury, Jupiter and Venus. Notes: For a native born in day time, the Sun in aspect to Mars and Saturn or the Sun in the company of malefies (i.e. Rahu, Ketu, Saturn or Mars) can cause father’s early death. This is more sure to follow if the house involved is the 9th or the 10th, If the Sun be in the ascendant with Mars and Saturn, not connected with Mercury, Venus or Jupiter (or even the Full Moon aspecting from the 7th), it may kill the father or gtand-father, Incidentally, if the (Full) Moon in 7th is aspected by Mars, the Sun and Saturn, unhelped by benefics, it may prove-adverse for the mother of the child. qa «= faaandl feaaorafrete | aragat at garg feat faery ora: uve qatagacrait afe gaat atest at atearest fad gatai wa ca fag: ues 47-A8. If the Sun is hemmed between two malefics or is conjoined with malefics, one born during day time loses his father early without any doubt. The child’s father at once quits the world if the planet Sun has Mars and Saturn in the 8th from him unaspected by benefics. Notes : The Sun is the indicator of father for day births. His being free from malefic connections is essential for a long life of father when the birth takes place during day time. Similarly, Saturn rules father for night birth and hence he ## Page 129 Chapter 10 125 should be well placed to help the longevity of father in the case of night birth. According to the above slokas, if the 8th from the Sun is occupied by both Saturn and Mars, longevity of the father is affected. This applies to a day birth. Inthe case of a night birth, if the Sth from Saturn is occupied by Mars and Rabu (or even by the Sun), the child’s father faces quick death. Hence, the 8th house from the Sun for a day-birth and 8th from Saturn for a night-birth should be well-disposed so that the father has a long life. qmagagraracefarat = fearee: = aa) fares maeaeTy — ftrereH went eearegarrat aaa oat acaasfe at arat: aa aaa geguld = ae APAT UYott 49-50. Ifat birth the Sun is ina movable Rasi along with malefics, the father of the child dies of poison, weapons etc, Malefics (or even a malefic) in the 8th, 9th or 7th from the Moon can cause death of the child along with its mother. afta gi feraenfa stfrt gaa waufa fataard araca attematey yen aeefrd att gaat ufaweritaa wat fataed saat frat sgaet xen 51-52. The fathe of the child was away at the time of birth if the Sun is in a movable sign, in case of day birth, and aspected by Mars. Saturn in a movable Rasi and in aspect to the Sun in the cise of night birth, denotes same results. aferafgaeg dteacrad ufsanfaraer waafe frereaat cet atsa are ARN wrerarea: = ragaefargaye: | gas seat fqd Raat fae sgaeT een ## Page 130 126 ‘Saravali- 53-54, In the case of night birth, if Saturn is in a movable sign along with Mars, the father undoubtedly dies in a distant place. If the Sun joins Mars and Saturn in any Rasi, the father dies before the birth of the native. Note : Sce sloka 46 of this chapter and notes there of, wRpeTasTaTdeag = aT arat gat are fead atean aeeg ean sitefe arent fad gg: sssratg mag) wergeaag a state qafata aarrat uve 55-56. If malefics are disposed in the Ascendant, 8th, ‘7th, 6th and 12th, the child dies along with its mother. There is no doubt in it. Should only the 6th and 8th be occupied by malefics, the mother does not die but the child dies. The ree is true if malefics are in the ascendant, 8th and the th. Notes: Both the child and mother die catly if malefics are in Lagna, 8th, 7th, 6thand 12th. Only the mother dies ifthe Lagna, 7th and 8th are occupied by malefics. It is the child that dics if the 6th and 8th are occupied by malefics. wat oar atgt at greed? aaagertt aferuaad dhl aramargreat gag nyent quesaccifecat gramme fafsoat agt earary HWA sya oa: aessa aT A NES wT areRmaTya gree ari aaa | mara gteaad cf: gail ae uve eantgatragr afe diet fereera ofa) wrereaaageat | fsafiered © Haare: nigon eaeTa great ax: gaze faftodt aay aarfa «-wacaet wagaassat: § arat wegn wafrat: ussrat frat gal <a: gaeg git aR HeraTTaATAaTeraT || MAU STTAT: ERM ## Page 131 Chapter 10 127 afrergqalegaarers? fratsa arsft aed ary freaconfaarte fz BAAYAZAT: NER afermagades: aed gq gternfse: wos) ahafrifaag: wet a ata Teetat nen formegaa afeat frat arsed aarfircera: | arasacnfaaree fz SATTHSD: EAN fran afrurad art aed ata fata aeaeg maa ot gtaaat attra eeu wata @ fafa athrefearecrfirasra: | gatgelataert ararehisia wat: NEON 57-61. YOGAS ADVERSE FOR EYES : Mars or Saturn in 12th can deprive the native of his eyes—Saturn right eye and Mars left eye. The native becomes blind if the Sun andthe Moon are in 12th while 6th and 8th are occupied by malefics. Even if one among the Sun and the Moon isin the 12th, damage to eye is indicated; the Sun affects the right eye while the Moon affects the left one. If Rahu is in the ascedant while the Sun is in the 7th, the native is blind by birth. Should the 2nd and the 12th be occupied by the Moon and the Sun, while malefics are in the 8th and 6th, person born is blind. If the Moon is in the 6th, the Sun in the 8th, Saturn in the 9th and Mars in the 2nd, simultaneously, the native is blind. Should the Moon be in the company of Mars and Saturn and be posited in the 8th or the 6th, the native loses his eye sight due to bilious and phlegmatic imba- lances. The said Moon should be conjunct other malefics, apart from Mars and Saturn. In this combination if the house involving the Moon is the 8th, the damage is to the right eye and if it be the 6th, the left eye is damaged. Should, however, this combination be aspected by bene fics, the damage is not at birth but will be later on. If the Moon is in the 8th or the 12th along with Saturn and be aspected by malefics, eye sight is lost due to windy and phlegmatic complaints—here also, the 8th ## Page 132 128 Saravali indicates right eye while the 12th the left eye And if benefics aspect the said Moon in the 8th/12th, the loss is not at birth but in the course of time, If the Moon is thus associated with Saturn and the Sun (in several ways), damage to eyes is to be predicted. Notes: There are umpteen combinations to know about eye affictions, thus : If the 2nd lord joins Venus or is aspected by him or is trinal or angular to him, adversity of sight should be expected. ‘The same result occurs if the 2nd lord is connected with Lagna Lord as above. The luminaries in the 2nd cause night-blindness. Should the lords of Lagna and 2nd house be in an angle along with the Sun, the child born is blind. Should these join the the 9th lord, the father becomes blind. (vide Parasara Samhita) See what Sarvartha Chintamani says in this regard : Should the lord of the 2nd along with the Lagna lord be in an evil house, loss of sight is caused. Night-blindness occurs if Venus and Moon join the 2nd lord. Mars in the 12th damages the left eye. Saturn so posited damages the right eye. The Sun and Moon in Leo Lagna in aspect to Mars or Saturn afflict the eyes. Eye diseases are caused ifthe 2nd lord is conjunct Gulika, Mars and Saturn. If the Navamsa dispositor of the 2nd lord joins malefics in a malefic Rasi, same effect prevails. wert ada gtuat weds afati aifaneat oat: eaearagfafad = aer: west wae qSaqaerat oaagethrat wet eaTay atairaraaga gatat BTAATAET UGE waa cfauat ari a aah wet aaqt aaa ateqh at guest at gH ATI Uwott 68-70. YOGAS ADVERSE FOR EARS: The Moon in llth, 3rd or the ascendant along with malefics causes defects ofthe ears, Ifshe is aspected by malefics, the effect is along ## Page 133 Chapter 10 129 with birth—ile. immediate. Should the 9th and the Sth be aspected or occupied by malefics, ear defects at the time of birth exist. Malefics in the 9th affect the right ear while in the Sth, they damage the left ear. Benefics aspecting or occupying these houses, cause on the other hand good in respect of ears. trat gerat sea at afery earfaareqarg 1 aerreq gtr waa aaEMTA a agZaq nog wearraeaat ata wer ANAT: | gat ui a fag aged cadtferat: ata: ween faferar fant etaq gene g fea gasyat og faaat get datrarcat wo 71-73. Whichever Rasi is indicative of a disease shall be treated as the limb to be afflicted by such disease. The Moon sign can also be similarly considered. Benefics cause birth marks on the right or left side of the body according to their occupation. Should malefics aspect these benefics loss of con- cerned limb should be expected. Malefics and benefics accord- ing to their association with the Moon and the visible and invisible halves (counted from Lagna) cause bad and good results in this respect. warfeett adtaedt dtrtarr at gt eae aa faaritarg fart aaa sitar non meant vat and coeds ary wat outa oi ataead? aaraarfieg now aft aanfat 7 wreea aca fe aar pein ah W9EN 14-16. DEATH IN FEW DAYS : The Sun and the Moon in the 3rd house identical with Pisces cause illness from birth and the child lives only for three days. If the Moon is in the 10th from the ascendant while the Sun singly or with all others isin the 3rd asterism from that occupied by the Moon, the ## Page 134 130 Saravalt child lives only for one night, The life span is just one week, if the Sun and Mars are in the 7th from the Moon. ageafeaat: aa araaferartt gar war at earfemretia cata @ sitafe won faaitet afart queaat art gar wag) aeaar aaa earfa grag a staf nosu faataedt ger aemrgeaisa ATERT: | aa geaifear gaafertr’ atfradat wen wat get-aguearaa: qesfeaat <a: 1 agramd a aeaat carfaafad: uso efadar sear fea area rraT iret: 1 fanta fara aaeer eorfiraatiaa: usen areafeaa: qa: dhoitefretfera: agar sreqaizartia a a siaferera usgn 71-82. EFFECTS OF TIME OF STARTING OF DIS- EASES: The following combinations prevailing at the time of commencement of a disease cause death in so many days as indicated : (1) Malefics in 4th and 8th from Lagna—10 days, (2) Malefics in 2nd and.12th from Lagna—10 days (3) The Sun in Sth while Moon is in 9th from -the ascen- dant—12 days. (4) The Moon invangle while the Sun is in-4thvor 8th— 3 nights. (5) The Moon in the 4th while the Sun is in the 6th— 18 days. (6) The Sun in the Sth or 9th from the Moon—=20 days. (7) The Sun in the ascendant or the 8th and in aspect to Saturn and Mars——will finally inflict death.on the patient. Notes : If the time of commencement of a disease isnot properly noted, then the application of these principles and.such ## Page 135 Chapter 10 131 others will lead to pit falls only. For detailed information, see Ch. 13 of Prasna Marga. gaat wet aly waaer seraa: 1 aa feanat stat saa ga ca a: sa wa gta: yal aa Fz aarafa: frat ame: sitaq sraarat feat usw gram wed alt ae ee agecfir: 1 faaa ores: aftaq orearal frasaft usu Reefs TET RATER: 1 arama: wargra vat ache stfrerq sen we: wagdadt faa aed oeafa ard aT MARTA aT ETT: ARTETA iso amzacea great feta agtga: aoa fags FF Fad: sqaa usu 83-88. Mars in Lagna or other angles while Jupiter is not so, causes death. The Sun in Lagna, Jupiter non-angular and malefics in the 8th cause immediate death. Similar results should be predicted if the Moon is in the ascendant, while Jupiter is ina place other than angles and malefics are in the 8th. Malefics in the 7th from the rising decanate while the Moon is in the ascendant will also cause death at birth. (In this case, the Moon shall be in the rising decanate while malefics shall occupy the 19th decanate). A majority of planets in the 8th— primarily malefics—indicate longeveity ranging from seven days to one month. A dead child is born if Saturn is in the ascendant while Mars is in the 8th, with Jupiter being not in an angle, Notes : Mars in Lagna, 4th, 7th or 10th can affect longevity, if not capable of causing infant death, when Jupiter does not protect the native by being angular, according to sloka 83 above. Other principles in the above group of slokas may accordingly be understood. ## Page 136 132 Saravali a: afar FaHTETTATAAIAT Fal WE: | wafaahat: oTTeaaATARAT «AAG seu a oanfararcitfa ai aeaitads qi eqaatfaawed ato ATA AAT Neon 89-90. MALEFICS IN RISING DECANATE AND TRINES THEREOF : Saturn in the rising decanate while a malefic is in the Sth and another in the 9th—the latter two should be exactly on trinal decanates as Saturn is—indicates disease. Mars in the place of Saturn in the said combnation denotes (infant) death while the Sun so placed indicates disease, deformity or death. Notes : If Saturn is in the first decanate of the rising sign-another malefic in the first decanate in the Sth Risi and yet another malefic in the 9th Rasi will cause disease of a serious nature. If Saturn is in the 2nd or 3rd decanate in the rising sign, then the other malefics referred to should also be in corresponding decanates. Similarly, Mars replacing Saturn will denote carly death while the Sun replacing will cause deformity, disecase or death. wa great whe: BexeaTs yA: Ga: | a a memaratfa great gaerra neg 91, DEATH : If at birth Mars is in the ascendant while Veausis in an angle, Mars causes death when he resumes the same point in the next round in his transit. Notes : Let us assume that Mars is in Aquarius ascen- dant and Venus is in Leo, an angle. After the birth, when Mars reaches Aquarius again, it is deterimental to the longevity of the child. So to say, such a child will not live for more than the period identical with one full course of the zodiac by Mars. He normally takes fortyfive days to traverse one sign of the zodiac, geferati great ata adlga: 1 aearaaraea: «ae oilfaaarat: neg ## Page 137 Chapter 10 133 92. If Jupiter is in a trine, ascendant Jord in the ascen- dant and Mars in an angle to one of them, it can cause immediate death. Note : In this case, Mars should be angular to Jupiter or Lagna. a tae ag: aheaq mat gleratsa at) aeraat =o sila sitaeaparaterey ean aaa eftaaraat a faett aaa qegat a Faedt attagaarfierq ues afe gemma: ye: Fee ge 1 aaa aa Wa: cag afaa waa TaT ney wat aaegheai gest aafadt. qereagat asf frat a a area ecu aa deamet: wT a fast a tary aeargencsed feate a aT neo 93-97. EXCEEDINGLY LONG LIFE : The native lives for 108 years if the 8th house is not occupied, while ascendant is free from malefic residence and Jupiter is in an angle. A span of over 108 years is granted if Jupiter and Venusare in an angle, while there are no malefics in trines and the 8th. Predict 120 years of life if Venus is in the ascendant, Jupiter is in an angle other than the ascendant and the 8th house is not occupied by malefics. Similar span of life is given if Jupiter isin Caneer ascendant along with Venus or the Moon while the 8th house is not occupied. If angles, trines and the 8th house are not occupied by malefics, one’s longevity is comparable to that of Gods. fromeeaaeratasier: atacageat: 1 qrat afaa: qUaterrarat wargta eargfuesht 98. ELAPSED LONGEVITY : Weak Moon along with malefics if posited in the 8th, 7th, 12th, Ist, Sth or 9th and unaspected by benefics will only grant elapsed longevity, i.e. immediate death. ## Page 138 134 Saravali Note: The occupation of weak Moon and malefics in the said houses, without benefic aspect is capable of causing death in childhood. at afer: carat ed at aed mash aT ae arafe oqdged aatayegera: earg neen 99, TIMING INFANT DEATH: When the child with powerful infant mortal combinations is in its first year, death will come to pass if the Moon with strength passes over the natal position of another qualified planet, or on its own natal position (i.e, Janma Rasi) or natal ascendant. In all these cases, the Moon should be aspected by malefios. Notes : The sloka gives clue to the effect of finding out the day of death in case of powerful child mortality. The Moon with strength in transit if moves over her own natal position or over the natal ascendant or over another planet’s natal position capable Of curtailing longevity can cause the end of the child. | fragt: gaaltgieadaed: 1 xfrafriteamesie ag afraid: ngoont <fran gaa: afitsatsie sh faarrafe tT t uarenfradzaretstt feat TTT got wee cia: gay aateait afte) eat a kage acafaeed ferret ugown aaicfaginaag: falegaararacitfeetisa ga: 1 adages ato arcaf fra thas ng03 100-103. DEATH IN CHILDHOOD : Any one group of the following planets’ joining in one house will cause death in five years: (1)-The Sun, the Moon, Mars and Jupiter (2) Mars, Jupiter, Saturn and the Moon (3) The Sun, Saturn, Mars and the. Moon. Even if a child is on the God’s laps, it will die in Tith year if the Sun conjunct Mercury is aspected by malefics. Death within 7 years of age will occur if the Sun is in the ascendant along with Mars and Saturn while declining Moon ## Page 139

isin the 7th in a house owned by. Venus, provided this combi- nation is not aspected by Jupiter: Should the Sun and the declining-Moon be in angles‘and be conjanct with or in aspect to Mars and Saturn, the child has a longevity of only 4 years. In these cases, i.e. where child mortality is indicated, there is no use of making any calculations. Notes : Each group of planets as above being together at birth can cause child mortality. The Sun and Mercury being in conjunction and in aspect to severe malefics can cause death in the eleventh year. If the ascendant is Aries or Scorpio, and is occupied by the Sun, Mars and Saturn waile the 7th house is tenanted by declining Moon (i.e. the lunisolar angle being less than 180 degrees), death in the 7th year is denoted. Jupiter’s aspect (on the 7th or the ascendant) is a redeeming feature. The ‘Sun in one angle; the Moon of dark half in another angle (i.0. the Moon with diminishing angular distance with reference to the Sun-for example when the Sun is in the 10th, dark half Moon can be in the 7th), and the company of or aspect to Mars and Saturn (i.e. Mars and Saturn can individually be: connected with the luminaries or both of them either connected with the Sun or the Moon), the 4th year of age will be fatal for the child. The author says that when child. mortality is powerful in the horoscope, no other calculations need be made in the matter of longevity. aenfarteaat aemreratsfagemat ata: | Ht THe aA gt: aafeafiteg areal now 104. DEATH IN THIRD YEAR: If waning Moon or Lagna Lord be in the Marana Pada and aspected by all the malefics, but not benefics, the length of life is only 3 years. Not Maranapada has been interpreted as 8th house by some. But it actually means the Rasi counted so many signs away from the Rasi in which the 8th lord is as he is away from the'8th. Note how many signs away the 8th lord is from the 8th, So many Rasis away from the 8th lord’s Rasi is Marana Pada, For example, take a Capricorm native, His 8th ## Page 140 136 Saravali Rasi is Leo lorded by the Sun, Assume that the Sun (8th Lord) is in Aries, ic. 9 Rasis away from Leo, the 8th. So count 9 Rasis from Aries, the Sun sign. We get Sagittarius, thus, as Marana Pada. ararfaafa: ora: atfariise fmm afe a aatgqy wifanterart areal far aafreed: ngoun aaah aterm: | wTEaTETR TaaATA ugimiarat amd aafe wSafiad: nog ug waawar afgqafretiad a greg: 1 zafaateat afgdzetata faaraafa gon 105-107. If all benefic planets are in the visible half of the zodiac while malefics are relegated the invisible half—Rahu be specifically in the ascendant—at the time of birth, the longe- vity is only 3 years. Should Rahu be in the 7th house in exclu- sive aspect to the luminaries and be unaspected by others, death before the age of 12 is denoted. aefagaftantaanaleafaciifad gcft xg: ard faterare: wataatafrad aa: ugos Rare: gd | Teargeatferaafraten: 1 OR oaraggt ort: aeSAA wT: goan aftoi qar aarg weaatg: war Ta areafa «dat faadtfreaist wf ta nego 108-110. If Rahu is in Aquarius, Leo or Scorpio identical with the ascendant and is aspected by malefics, the life span is only 7. If Dhuma Ketu rises followed by fall of meteor and strong gale and if birth occurs in Raudra Muhurta or Sarpa Muhurta, the subject invites early death. Notes : Rudara Muhurta is for four ghatis Sun-rise while ‘Sarpa Muhurta rules for 48 minutes from Sun set. If declining Moon is conjunct malefics, aspecting Rahu, death within few days of birth is to be declared, ## Page 141 Chapter 10 137 gra feafe wargt amt aed aaafaaret | fag a ocemad at a wad adalaa: nee afafa fataage’ Aa a aags fafa qaqa) wees aan gif agi at fa ure wart sate oo agtspra we za) faga a atta mat sya ATR: UgRRU \ dyer: afer weaft aaideg araig: Re fe HRT TIT CATT TAT TATA URS 111-114. FATEFUL DEGREES OF THE MOON: The Moon is capable of inflicting death ifshe is in any of the following degrees at birth: Aquarius 21°, Leo 5°, Taurus 9°, Scorpio 23°, Aries 8°, Cancer 12°, Libra 4°, Capricorn 20°, Virgo 1°, Sagittarius 18, Pisces 10° and Gemini 22°. If the Moon is in such degrees at birth, death is indicated in the corresponding year and the native cannot be protected by even God Yama. Notes: Should the Moon be in any degree as above, death occurs in the corresponding year. For example, if the Moon is in 23 degrees of Scorpio, the person dies at the age of 23. Horasara states that the fateful degrees for the Moon from Aries onwards are 26, 12,13, 25, 24, 4, 26, 14, 13, 25, Sand 12 and the same for Lagna are from Aries onwards: 8, 29,22, 22, 25,14, 4, 23,18, 20, 21 and 10, Phala Deepika (Chg 13) has the same view of Prithuyasas. Jataka Tatwa (B-138) also denotes fateful degrees for the Moon from Aries onwards respectively thus : 8,9, 23, 22, 5, 1, 4, 23, 18, 20, 21 and 10, These are death inflicting degrees in the respective year of age. ‘These can be used in horary also relating to questions on death of an ailing person. . SA ad sata oaeraea fea: _, Stereararft Fearfn faractarfs saat urea ## Page 142 138: Saravali. featsrraarmer cart uf froma: | agenfay mt | sitaerenrerey agene: ueegn aga gi WaamanAaty aT qa wera & ora Maat sitafeererreeat: ug gon: qeaamzanaraaticania = faaee farareceatizag Tara FATS BTA: NSU 115-118, Assess the strengths of ascendant, angles.eto: at birth. Jupiter is llife spirit of all natives. The time of death should be known through Jupiter. If he is in the-3rd, 4th, 5th, 7th; 9th, 10th, and 11th or ascendant, he proves fatal at the age of 5. 10, 46, 20, 30, 40 and 50 respectveiy. Notes : Jupiter in 3rd will prove fatal at the age of5,, im the'4th at the age of 10, in the Sth at the age of 46 and'so: ons. Should however the ascendant and kendras are with strength, he'does not prove fatal in the years specified. xfa searmadfaefaarat arcraeat afegiearat eam: ten Thus ends the 10th chapter entitled Evils at Birth in Kalyana Varma’s Saravali, aa aeqifterareara: ure Chapter 11 Evils and the Moon’ agarfegreat vyeaat zat wat HART: ararrrat ae TETRA | weEASA UU serfrgatert ayearatreaa gay) wag Formal aad aagatary nen 1-2. I now explain the combinations that are capable of nullifying the said evils, for these'are important’ in'the Science ## Page 143

of Horoscopy and intially explained below aro the yogas to counteract the evils emanating from or afflicting the Moon, as done by expounders like Lord Brahma. Notes : In this chapter, the combinations to counteract the evil influences of the Moon are discussed, so that there is no fear of child mortality. frsz means child mortality or ‘atetfeez in this chapter and 12th chapter. But they should not be profitably interpreted as though there will be no blemish in other matters, like marriage, living etc. aairraig grat | faaraafae feeqs orgdaregiadat | qT: BATTS TRU wa: arpiag: gaa frit: gear feegerat Sse) aragerat gat afer: wen 3-4, If the Moon is Full and is aspected by all heavenly bodies, all evils are countered just as lawbreakers are destroyed by the king. Venus aspecting the Full Moon while the latter is in friendly divisions is capable of obstructing evils just as abdomenal remedies are able to cure windy diseases. Notes : The full Moon in aspect to all planets is capable of nullifying evils against longevity If she is full and is aspected by Venus, then also the evils for short life will vanish, In the latter: case, the Moon should simultancomsly be in friendly divisions. wd . In this chapter, the high degree of knowledge of medical branch of Kalyana Varma should be usefully noted for. its worth. qos’ fafreagy gerafriifad exit feorqy wafateard oneftert omar dtp un wa: guaviea: eftaisia gift gcft fezqy wefaa oo ngiftaré =| areiteraenoraafaay usu 5-6. Should the Moon be in her deep exaltation and be aspected by Venus, evils are countered just as phlegm and bile are controlled by induced vomitting. If the Moon be in the ## Page 144 140 ‘Saravali divisions of benefic planets and be aspected by benefics, she will not prove evil though she may be waning, just as nut meg bark treats dysentery. warecnasseat: Tha: dtar geafcernery | aracfaeraret: wea qaATAZ Wott yea: yancatfafafeg: §« aafageeafceatt aaa sat = ware faqraegaueing ust 7-8, Benefics in the 7th, 8th and 6th from the Moon remove all adversities, just as madness is removed by Kalyana Grita, Same is the case if the Moon is conjunct benefics and be in the decanates owned by benefics, just as saline water controls ear diseases. Notes : So to say, a powerful Adhiyoga can give great longevity. Further, if the Moon is conjunct benefics and falls in benefic’s decanate, long life is indicated. arqdnragiasieram gue af aE feet aafa fant aarraral gar gaz nen aterdta oaedt gterafaat fatima ghar fed a aifadised: garqargafRaraat gon 9-10. Should the full Moon be in a benefic’s Dvadasamsa, allevils are removed just as butter-milk checks piles. If the Moon occupies a benefic’s Rasi and receives the Lagna Lord’s aspect, adversities for short-life are counteracted as even a noble housewife can destroy the fame of the descent if she seeks union with other men. wUAAR WANTS « wanafaetferreragay wafa fae sored gam et ae TAT eet wanfacfadaary gefaeitatine: Gates t feeeq wilft war dette sreaaara: eat 11-12. Even though the Moon may be ina house owned bya malefic or in such Vargas, she docs not prove evil if aspected by her dispositor. This is comparable to a miser protec- ## Page 145 Chapter 11 141 ting his money. If the dispositor of the Moon is strong and be in aspect to benefics or friendly planets, the Moon is not capa- ble of harming, in comparision to a timid person who cannot face others even though he may be in war fleld. Notes : A planet proves favourable though it may be in malefic divisions if it is aspected by the lord of the Rasi it occupies. Secondly, the strength of the Moon sign lord is essential to promote longevity of a person. safari ge: aafanraafa freq qelsaiaearrat TaHRATSAT FAT YITA URW eateaeaeaqesaaria gaat vist ateaseat age: quatfira: aaact a eaatasaat 1 mamas a afte: sreegaa frat fod after grat feaafa: staat wat ugen 13-14, If the lord of the Moon sign is in Lagna and is aspected by all planets, all evils are removed, just as the oint- ment of holy fig and bamboo bark removes whiteness. The Moon in her exaltation, own, friendly or benefic Vargas, aspac- ted by benefics but not malefics, counteracts all evils as the the Sun does remove fog. afaitse’d gaftadter a ty areaet wT t fea arafaniea anafe afagacared: neu 15. Just as quartan fever is removed by inhaling Agashya flower, all evils are checked by Mercury and Venus in the 12th of Moon, malefics in the 11th and Jupiter in the loth. Notes: Mercury and Venus in 12th, malefics from 11th and Jupiter in 10th, all with reference to Moon, are capable of contributing to a long lease of life. When Murcury and Venus are in the 12th of Moon, the Sun will also be close to her. Even though she may be week, her angularity to Jupiter is the key to the above Yoga at birth. wraearea wa: czfaaaraiggty Bre: aaafe aneaicceragard® aafreter ga ugen ## Page 146 142 Saravali wat werfrafa: = afeqeiat: «= gees afta frarmefeer cota ga AAT AA A Ugwtt 16-17. Should the Moon be in the 6th, 3rd, 10th, 11th or 4th from the natal ascendant, and be aspected by benefics, evils are removed as though a king destroys his opponents. The lord’of the Moon sign is singly capable of removing all evils if he is with full strength and aspected by benefics, similar to an inebriated tiger throwing away a thousand deers. Notes : In this chapter, the author has described the role of the Moon in the matter of longeveity and these combina- tions be uscfully analysed. fa wearmadfacfaatat areacat Taree: 1g RI Thus ends the 11th chapter, entitled “Evils and the Moon” in Kalyana Varma’s Saravali. BT ABARAT: Ue AU

walframiaaa: 9 eqedgeat am feaa: cantg geil) wal agit ghatf ggrazrie weal saw Fa wHAT oTUTT: UN 1. A very brilliant Jupiter (i.e, not being devoid of rays) is capable of counteracting all evils if he is in the ascendant just asa single sincere prostration before Lord Vishnu, the wearer of Sudarsana Chakra, relieves one of the greatest sins. Notes : The previous chapter dealt with evils countered with reference to the Moon while the present chapter deals with evils checked by other planets, viz. Jupiter etc. ## Page 147 “Chapter 12 143 Jupiter willbe in fall in Capricorn and his position-in ‘Lagnarmay not give long life as the 12th lord will be in‘fallin Lagna, He also rules the 3rd, which is another house concera- ing longevity. If, however, in being so, he has strength acquired -by number of rays (vide ch. 36), he can turna mender.and confer long lease of life. aiteaneciaad faeces aa. wea a dhawad guetta watrerfaciget waft qa: gare: ey gar sfeaigrary uN 2, -Benefics with strength and malefics without it remove all evils if ascendant falls ina benefic’s house and is aspected by benefics, just as those who worship planets will have -nmo-sins left to their liability. ‘Notes: There are four conditions to be free from longevity evils : These are (1) Ascendant should fall in benefic’s “house, like Pisces, Libra etc. (2) It should be in aspect toa benefic (3) Benefics in general should be strong (4)Malefics should. be weak. Inthe above bargain, 8th lord though may be a malefic »should:bave strength as his weakness will only imbalance'the «good of the yoga referred of above. art afe quad atedg'cet: 9 guisenied: 1 freafa aat fest ofa facaat oar gafa: nan ugieaassat® « earg ateafadifina: aay arrafa aagitd area ga qaaeraq neu wtataitg ufrg aainarfiarfata: gat sefredratiet § fafisad aafrarfeesy nun 3+5.'If malefics occupy the Rasis and Amsas of benefics “ie. such benefic divisions) and be in aspect to benefics, evils are sremoved-just as a dejected lady remains away from her,hus- vband, Should Rahu be in the 3rd, 6th or Lith fromthe ascendant and be aspected by benefics all evils are destroyed.as ## Page 148 144 Saravali though wind carries away a heap of cotton with it, Ifall planets be in direct motion and in Seershodaya signs, all blemishes are removed just as ghee is burnt out in fire, Notes : (1) Malefics should be in benefic’s divisions (2) Rahu in 3, 6 or 11 is aspect to benefic. (3) Alll planets should be in Seershodaya signs and be in direct motion. Each of the three combinations in capable of giving long lease of life. mente af faseit guag: gufrctferctisasay 1 asiafa adie? ared ga Tear FAA: EN afefacal area: wtaa facitfnet geht ay 1 end oafafgarat gd war WreRTTET Won 6-7. A benefic planet victorious in planetary war at birth and essentially aspected by another benefic, destroys all evils just as gale can uproot trees. If a’planet has a halo (in the sky) and is aspected by a malefic, evils are countered just as the solar eclipse day bath in Kurukshetra does. Notes : There must be a benefic involved in planetary war and must be victorious and be in aspect to another benefic, Then only, the yoga comes to pass. Two planets are said to in war (except the Sun and the Moon), when they are in con- junction and within a longuitude of one degree. The one with less longidude wins the war. For example, Jupiter and Mercury are in Taurus at 24° 10’ and 24° 29’ respectively. Jupiter is declared successful as he is behind Mercury. ferengraaaTl arama ada Bat: AAT: | eae: area fest aaafa eat aaregarete: ust vad ameage: aadiat avifagatare watfecd aeafa am ga gated oma: nen 8-9. If there isa pleasant breeze at the time of birth, and the sky is with pleasing clouds and the heavenly bodies be with splendour, the evils disappear ina fillip just as rains settle dust, If birth takes place when Agasthya and others of ## Page 149 Chapter 12 145 Saptharshis (Alfa Carini or Great Bear) tise, all evils destroyed, just as darkness disappears when the Sun rises, Notes : The Seven Seers (or Saptarshis or Alfa Carini or Great Bear) traverse each lunar mansion in 100 years, They are Marichi, Vasishta, Angirasa, Atri, Pulaha and Kratu. Arundhati is always close to the sage Vasishta. The star Marichi is in the east, Vasishta is to His West, Atri is to the west of Vasi- shta; close to Vasishta is Paulastya followed by Pulaha and Kratu. saqaatefaars cafe tg: TACATSTAT: | qeattaft: cart: SATA «AAT: FETT gout Maferrmet: ea et Tad Fae ass apafacd aaafa fafat aarsare: neen 10. Rahu in the ascendant identical with Aries Taurus or Cancer protects the native from the clutches of all evils just as a pleased king forgives the crimes of a person. If all the planets (not of course the nodes) are in their own deca- nates, all evils are removed just as the Sun removes darkness Notes: If Rahu is in ascendant identical with Aries or Taurus, or Cancer, the person enjoys great longevity. This view is supported by Horasara (p. 63), Jataka Martanda, Sarvartha Chintamani (ch. 11, S. 16), Jataka Parijata (ch. 4, $.90), and Jatakadesa Marga (ch. 4). See the horsocope of Swami Sivananda with Rahu in Cancer ascendant conferring a long lease of life, as under : Born on 8-9-1887 at 4,34 a.m. IST (Lat 8 N 48) ## Page 150 146 Saravali Moon Ketu | | | Jup. | Venus | The ascendant and Rahu are just 3° apart in Cancer, thus ascendant receiving full influence of the node. Jupiter aspecting the 8th house (longevity) and also the Moon may be noted. went afe quasar: @ereaarit atid frog) qalq feat wet ada grat ater ean 12, If at birth, many planets are capable of giving benefic results, even then there is no blemish just as the king gets success in journey undertaken when the Moon is in a trine to the Sun. Notes : There are two important clues in this sloka. Firstly, if a majority of planets are beneficial to the native, the other malefic combinations get nullified. Here is a clue to the effect that awisdom-based judgement is necessary-in astrology and rushing to conclusion by surface study is detrimental. The second clue is: if the Moon is trine the Sun, at the time of a query, success in journey is indicated. qegat a eaeat siagdad at arfsr fgreary warfter aria a nga 13. Should Jupiter and Venus be in angles, evils arising out of the various Rasis (ie. Bhavas) and of the Moon are countered. And the native lives for hundred years, Notes; Although there may -be afflictions. to longevity ## Page 151 Chapter 12 147 through other bhavas, yogas and other planets, if only Jupiter and Venus are angular from Lagna, the subject has a long lease of life of 100 years. In such yoga, even the blemish to Moon, if any, is perfectly balanced and the Moon remains actually unafilicted. wearerdaafacrama: «Fee TMatwaraafaa: aware az!) aS vfagararayt a ary ghasararatcafad = FATA: newt 14. If Jupiter and the Moon be in Cancer, identical with 4th, 10th, or the ascendant, Mercury and Saturn be in Libra while others are in the 11th, 3rd and 6th, one has illimitable longevity. Notes: The Moon and Jupiter. should be in Cancer as Lagna or in 4th in Cancer for Aries ascendant or in 10th in Cancer for Libra ascendant. Additionally, Saturn should be exalted joining Mercury, while the Sun, Venus and Mars should confine to the 3rd, 6th or 11th from Lagna. This rare yoga bestows a very long lease of life on the native concerned. wa aa AB vat fea: geraat: far: 1 aatazafaat AURATETTATAT AT UREN 15. Ihave thus explained the Yogas that are capable of countering the evils, as laid down by our great ancestors. May the astrologers please the king with the knowledge of these. Notes : The yogas explained in this and the previous chapter are guidelines only to know the combinations that counter child or infant mortality and relate only to longevity. As already cautioned, these do not necessarily work for all kinds of defects as antidotes. For example, a certain combination explained in this context will not necessarily offset an imbalance in one’s education, marriage, progeny etc. fa wetrgadfacfaarat arcacai awaifcgagt art area IseaTa: 12 Thus ends the 12th Chapter entitled “Cancellation of evils at birih” in Kalyana Varma’s Saravali. ## Page 152 148 Saravali BA ArAAATETT: 230

qrarsanr-geaet Haha ae: wa Te kea: | faarataaded: Sraarareranteat: ug 1. SUNAPHA, ANAPHA AND DURUDHURA YOGAS : Excepting the Sun, aay other planet in the 2nd from the Moon causes Sunapha yoga, in the 12th Anapha yoga and in both the 2nd and the 12th Durudhura yoga. Notes : Just as the Sun, the nodes are also not considered in this kind of Raja yogas. The Moon should have a planet either in the 12th or in the 2nd (or at least with it) so that she remains balanced. Otherwise, Kemadruma yoga is caused, as could be seen in the following verses and notes thereof. Unless the Moon is thus well-balanced, the native is not likely to feel comfortable in life. He will face only obstacles in day-to-day affairs. The said 3 yogas as per the present sloka are caused only by Mars, Mercury, Jupiter, Venus and Saturn. ach position by a different planet manifests varied effects, vide infra. Ua waar aie: Feragatora: TANGA 1 Sageistrnce: ata aaeaagtest ue 2. KEMADRUMA YOGA : Kemadruma yoga is formed if at least one of the said three yogas (viz. Sunapha, Anapha and Durudhura yogas) is not present or if the Moon’s angles are devoid of planets or if she is unaspected by all the planets. Such yoga causes extreme difficulties, Notes : Elaborate notes and comments can be found in my English translation of Horasara (P, 230) which the reader may consult, ## Page 153 Chapter 13 149 Kalyana Varma uses amea agies? thereby requiring the Moon to be in aspect to all planets in deviation to standard textual versions. As otherwise, he states, the Moon produces Kemadruma yoga This condition is quite strange. grarrarsenticrtata (30) feaagut afte:(gco) 1 ae ategerai searefaet = aareqrar: zu 3, DIFFERENT PERMUTATIONS : By all possible permutations and transmutations, one can see 30 kinds of Sunapha yoga, 30 kinds of Anapha yoga and 180 kinds of Durudhura yoga. Notes : We have learnt that any planet other than the Sun in the 2nd of the Moon causes Sunapha yoga, Foa example Mars in the 2nd of the Moon causes Sunapha yoga. Similarly, the other four i.e. Mercury, Jupiter, Venus and Saturn indi- vidually cause Sunapha yoga. Thus 5S kinds of this yoga is formed in the first instance, With group of two, these 5 planets can severally form 10 kinds of additional Sunapha yoga. For example Mars plus Mercury or Mars plus Jupiter or Mars plus Venus and so on and forth. This is the second set of 10 permutations. In group of 3 each, these 5 planets can form again ten permutations in the third instance. For exmple, Mars + Mercury +Jupiter or Mars-+Mercury+Venus and so on and so forth. In the 4th instance, these 5 planets in group of4 each can cause 5 different permutations, such as Mars+ Mercury +-Jupiter-+Venus or Mars + Mercury +Jupiter + Saturn etc. Inthe Sth instance all the 5 planets in the 2nd give rise to one transmutation. Thus these 5 different transmutations cause in their order 5+-10+10+5+1=31 kinds of Sunapha yoga. Same transmutations can be conceived with these 5 planets in the 12th for Anapha yoga also and we get 31 different yogas. Similarly, disposing these 5 planets in the 2nd and 12th in group of | to 5, we can conceive 180 kinds of Durudhura yoga transmutations. Parasara in his Brihat Parasara Hora Sastra (ch. 37; sloka 13-my English translation) observes thus: The yogas (like ## Page 154 150 Saravali Sunapha, Anapha, Durudhura, Kemadruma, Chandradhi yoga etc.) prevail over the other good or bad yogas in the horoscope. Hence one must beforehand analyse the good and -bad effects of yogas from the Moon. ata crargiawal agadaita: arearifagagaar: = eagurfrea: ara: det fiafeafa: afeatsa at earq gat: gary fagaet: gaerfrara neu 4. EFFECTS OF SUNAPHA YOGA: One born with Sunapha yoga will be wealthy, will have self-made prowess (or will reach an exalted position of his own efforts), be very virtuous, be learned in Sastras and their meanings, be very famous, virtuous (like Lord Rama)!, be peacefully disposed, happy, be a king or a minister and be highly intelligent. Notes: The word q@t apart from meaning “happy” has various meanings like : agreeable, charming, sweet, joyful etc. One born with Sunapha yoga will be a king or equal to a king, be wise, rich, famious and will earn wealth by his own efforts, (vide my English translation of Brihat Parasara Hora Sastra ch. 37, sloka 8). Prithuyasas in Horasara (Ch. 19) also adds that this yoga gives self-made wealth. The native will have rich knowledge of Sastras and be a commentator thereof. Jatakabharana in chapter on “Chandrayogas” asserts that the native will have self-made wealth, will enjoy fame, wisdom, and all kinds of happiness, be a scholar and a minister of the king. Thus, planets other than the Sun in the 2nd house counted from the Moon promote the prospects of the native’s having self made riches. If the planet in question be Venus or Jupiter or Mercury, the subject can earn a fair amount of wealth, Exalted Saturn or exalted Mars will also give good results in this regard. 1. ggqifaaat js another reading. 2. Fd: is another reading meaning splendorous. ## Page 155 Chapter 13 isi anat syifamara: gzitet wWaaraaagarracariaatary | zara: aatigage: = geaeafadt at fameced cath gta un 5. EFFECTS OF _ANAPHA YOGA : One. born. in Anapha yoga will be eloquent in speech, magnanimous,, virtu- ous, will enjoy food, drink, flowers, robes and females, . will be famous, calm (aatfga) in disposition, happy, pleased. and will possess a beautiful body. Notes: According to Brihat Parasara Hora Sastra (ch: 37), this yoga makes one a king, free from diseases, blessed with all kinds of happiness, virtuous, famous and beautiful. One born in Anapha yoga will have political wisdom and moral training, be steadfast, will know many sastras) be blessed with cnormous wealth, be capable of attracting the fair sex and be honoured (vide P. 228 of of Horasara.) Thus, this yoga gives plenty of wealth, if for example 12th from Moon is occupied, particularly by exalted Venus; or when the Moon is in Leo while Jupiter is in Cancer; or when Mercury is in Virgo. with Moon in Libra. Dundhiraja in his Jatakabharana also praises Anapha yoga. The effects are : good conduct, kingly status, beauty etc. The Anapha and Sunapha caused by a debilitated planet will only yield adverse results, Forexample when the Moon is in Libra with Venus in 12th in Virgo, Anapha yoga produces only immoral “conduct instead of good conduct. Such natives cannot enjoy physical comforts, long life etc. amafefaragt: sfaa: qfreat TaAaaaTaTETTTT 1 ale HeramaTaaAeaaE: aeeary gagerwat feet: ug ## Page 156 152 Saravali 6. EFFECTS OF DURUDHURA YOGA : One born in Durudhura yoga will be famous on the earth for his speech, wisdom, valour and virtues. He will enjoy freedom, comforts, wealth and conveyances. He will be liberal but will come to grief by maintaining his family members. He will have good behaviour. Notes : One born with this yoga, will enjoy the comforts generated by him, be charitable, and be endowed with wealth, conveyances and attendants (See ch. 37 of BRIHAT PARASARA HORA SASTRA). According to Horasara, P. 228, such a native will enjoy luxuries and wealth. He will be an eloquent speaker, be fond of battles and be an army chief. He will be in a state of bewilderness, be kingly and sacrifying in nature. He will have cattle, Vide Jatakabharana, the native will enjoy wealth, conveyances, lands etc., be equal toa king and be happy with women, Compared to Sunapha and Anapha yogas, Durudhura yoga is more effective as it is not that frequent to occur. The Moon gets enormous strength to yield good effects if she is Planked by planets on both the sides. The native, according to Parasara, is destined to experience comforts of his own. BUATATATEATCATE eat arfeagranadaadeta: 1 Sea: aa: amacitafrezafa: Rage wale ofsadasitsti won 7. EFFECTS OF KEMADRUMA YOGA : The native with Kemadruma yoga will be deprived of wife, drinks, food, residence, robes and friends, though he may belong to regal scion, He will suffer from poverty, grief, sickness and be dirty. He will live by hard labour, be wicked and be inimi- cally disposed to one and all. ## Page 157 Chapter 13 153 Notes : The native with this yoga will be blameworthy, be devoid of intelligence and learning and will experience penury and misfortunes, vide BRIHAT PARASARA HORA SASTRA, ch. 37, sloka 12, Prithuyasas in Horasara emphati- cally declares that even a king with this position will beg (p. 230). According to Jatakabharana, one with this yoga will resort to unacceptable professions, be dirty, will present himself in bad dress, be a servant, will live in distant countries, and be devoid of wife, sons, friends and money even though he may be of a royal scion, Manasagari, however, attributes long life to the native while describing other bad effects. It adds that the said Kemadruma is defunct if the Moon is in a. benefic’s Rasi and is conjoined with Mercury or Venus or Jupiter. aeareeaigaim: = atfrat = Asaerem: ar sara aan airerety fafaraaq usu abrditi at fat eT eG TTL fama osatq amg gatifasd GAT ue 8-9. OTHER KIND OF SUNAPHA ETC.: The kind of Sunapha yoga etc arising from the Moon’s angles are (also) important. ‘These yogas give effects according to the state of the Moon (ie. depending on her rays, being Full, New etc.). The strength of the planets, viz. Mars etc. causing these yogas, native’s country and the race he belongs to must be properly understood before evaluating Sunapha etc. Notes : A different set of Sunapha etc. may be noted as under : If a planet other than the Sun is in the 4th of the Moon, Sunapha yoga is formed. Similarly the 10th house position causes Anapha and occupations of both the 4th and 10th cause Durudhura yoga. This account is given by Srutakirti. Another view is of Jeevasarman which indicates that the ## Page 158 154 Saravali 2nd and 12th houses in the Navansa chart with reference to the Moon shall be considered for these yogas. It seems that Srutakirti’s yogas too have meaning in this context. feanfrasrat faograraarayafaracs: | feet oo aenfactedt | o gaarat dtd non afamentagaat wae: Breage a1 waft cfarag: gaat atx wate ure 10-11, RESULTS OF SUCH YOGAS CAUSED BY MARS ETC. : If Sunapha yoga is caused by Mars (by being in the 2nd of the Moon), the native will be valorous, wealthy, cruel in speech, be an army chief, will be fierce, torturous, proud and inimical. If Mercury be the cause of Sunapha yoga, the native will be expert in Vedas, Sastras and music. He will be virtuous, and a poet. He will be high-minded, intent on thinking of good for all and will possess a brillant physique. Notes: Sunapha yoga caused by different planets from Mars to Saturn have different effects. While analysing a given horoscope, these effects further vary according the Rasi involved and the lordships of the planet concerned. For example, Mars may cause Sunapha yoga for a Capricorn native which can give enormous wealth while for a Virgo native this planet will only .give very ordinary wealth as he is the lord of the 8th also, Jataka Parijatha, ch. 7, slokas 86 and 87 attribute similar results as per Kalyana Varma for Mars and Mercury individually causing this yoga. According to Manasagari, this yoga by Mars causes perennial enmity with others. For Mercury same results as per our text and Jataka Parijatha are mentioned. In fact, Manasagari and Jataka Parijata have exactly followed our author's views for effects of Sunapha, Anapht and Durudhura yogas by various planets. ## Page 159 Chapter 13 155 farrard ea aif asfefed arsfiry Baars gastat | gTye: FEA URW weafrafararagerarsa: giant wale aqaepa: geatel ae: TSM TABATA ga faguatauingtind = dg fat anage:. aasrat vga frag gait waate: nes 12-14, Should Jupiter cause Sunapha yoga, person so born willhave high learning, will be famous and himself be a king or dear to a king. He will have a good family and have plenty of wealth. Venus will give wife, lands, wealth, prowess, quadrupeds and valour. The native will further be honoured by king and will also be courageous. Should Saturn bein the 2nd of the Moon causing Sunapha yoga, the native will be skilful, be worshipped by the people in his village and city and will have wealth galore. He will be devoted to his work and be brave. ateeartl ase: cage rat caitene: Fle es: sate: Fag: RaSTHat aAATATA UU meadtare: fa: naam: | POTATAEHTT: | wfarageararat «osfageat ogda | wag neat aitacatararen gfear paras: aasrat | faenget «dra: = aenfaniaft neon gaclarafaqan: surat ferfarer wary ara: 1 ea: | waRAgeerrarat ara waft nes feattigat = Rat aglaaraaraguaaga: | qafrarat aaat qualerrarsgag ue ## Page 160 156 Saravali 15-19. ANAPHA YOGA'S EFFECTS GIVEN BY MARS ETC.: If Anapha yoga is caused by Mars-being in the 12th from the Moon-the native will head a band of thieves, will be arrogant in disposition, be honoured, fond of war, given to anger, good, praiseworthy, good-bodied, and proud. If by Mercury, the native will be an expert in singing, doncing and writing, will be a poet, and an able ‘orator. He will be conferred honours by the ruler, will have a brilliant body and will perform famous deeds. Should the yoga be caused by Jupiter, the native will be majestic, strong, intelligent, fond of assembly, famous through a king, and will be a poet. Venus causing this yoga gives an exceedingly great liking for women, The native will be dear to the king and will enjoy pleasures He will be splendorous, famous and will have abundant gold. If Saturn causes this yoga, the subject will be broad-shouldered, be a leader, be inclined to keep up his commitments, be rich with quadrupeds, devoted to an infamous lady and be virtuous, arafaat agfaet frguitsferarctsfirrt yee: 1 qaradisaaa: Zara: afar vtageTAed uot 20. EFFECTS OF DURUDHURA YOGA CAUSED BY MARS ETC.: If Durudhura yoga is caused by the pair of Mars and Mercury, the native will be a liar, be very wealthy, expert, very wicked, greatly miserly, addicted to an old lady, and be chief in his race, era: wig faut aguaacecaniat ge: 1 gre gaya: aeqgdite: aff wed Ren 21. If Durudhura yoga is caused by Mars and Jupiter, one will be famous by his deeds, be mighty (or wealthy), inimically disposed to many and disposed to anger, will protect his men, and will gather money. vena: gat faarasita: « qfaiaazer: 1 wart ware: = faereahieat wR RAN ## Page 161 Chapter 13 157 22. Ifthe Moon has Venus and Mars on either side, the native will have a virtuous wife, will be fortunate, argumen- tative, pure, skilful, will like doing exercises and be bold in war, gkaanfarrm agdarareal aaa: | wen frqat fegeramreat: earggegerary uaa 23, If Saturn and Mars plank the Moon, the native will be the husband of a bad lady. He will save a lot of money. He will have vices. He will be given to anger and be a tale- bearer. He will win over his enemies. ada: meadt arate: deplete: 1 aga) frerrat guyana feat ai uw 24, Should Jupiter and Mercury be on either side of the Moon, the native will be virtuous, learned in Sasthras, garrulous, be a good poet, be wealthy, capable of making sacrifices and be famous. fraara GT: Brea: TACT fat wale | aa: A wet | gqufaaatdegeratt eu 25. If Durudhura yoga is caused by Mercury and Venus, the person will be a sweet speaker, be fortunate, splend- orous, beautiful, be fond of dance, singing etc., be served, valiant and be a minister. aargea weafa facet arfafaaar afga: 1 wastat qea: camafattet areahied ue 26. If Mercury and Saturn plank the Moon, the native will move from one country to the other to earn money. He will not be much educated, will be worshipped by others but be inimical to his own men. afetearataget aaa: waneerafeqe: 1 erat qgeratt gefeaatgagerm gon ## Page 162 158 Saravali 13-27. Should Jupiter and Venus cause this yoga, by being on either sides of the Moon, thenative will be courageous, intelligent, will have political wisdom, will possess gold and gems, will be famous and be in the employ of a king. qenafaamqa: faaarfiaary geerdtscara: | arate ASTER QUATGITTeA NASH 28. If Jupiter and Saturn be such planets as to cause Durudhura Yoga the native will be happy, will have knowledge of politics, will be sweet in speech, learned, peaceful, wealthy and good looking. qaaftd gaei fag edtacad qaaysat qqesd aged ged aa: franfaaat: ure 29. One who has Durudhura yoga caused by Venus and Saturn will conduct himself like an old man (i.¢. so mature), be chief in his race, skilful, dear to women and will have plenty of'money. He will be honoured by the king and gather abundant wealth. Nctes : In assessing these Sunapha, Anapha and Duru- dhura yogas—for that matter any Raja yogas, we should take due precaution, Should the planet be in fall, be in an inimical house and the like, the ellicacy of the yoga is reduced. On the other hand if it is exalted, is in a friendly house etc. the results will be still better. qatq Searferal frarae: caetrerayfassry | gate eaitigufaarafaaatiza uz 30, LUNAR YOGAS FROM THE SUN: If the Moon is in an angle [rom the Sun, little effects will be felt in regard to money, wisdom, skill, learning and modesty. These are medium if the Moon be in Panaphara (i.e. 2nd, Sth, 8th and 11th) and exceedingly good in Apoklima (i.e. 3rd, 6th, 9th and 12th). Notes : Should the Moon be in the 6th or 12th from the Sua, she promotes one’s learning, wealth, wisdom etc. Phala Deepika designates these yogas (vide ch. 6, sloka 14) thus : The Moon in an angle of the Sun causes Adhama’ yoga; ## Page 163 Chapter 13 159 in Panaphara it causes Sama (a4) yoga and in Apoklima, the yoga is termed as Varishta yoga. The results ascribed are (sloka 18)—wealth, conveyances, fame, happiness, intelligence, wisdom, learning etc. in little quantity for Adhama yoga, in medium quantity for Sama yoga (aqatt) and the highest for Varishta yoga. aenfas: gragiaft arcageat gaa) fear fafregaaattea: earq | va feaa: aad ghaatafacd arasarat sped ofequigie: uae 31. MOON IN VISIBLE AND INVISIBLE HALVES : Tn the case of a night birth, if the Moon is with Parivesha (halo), and be declining in the invisible half of the zodiac (ie. being posited between Lagna Bhava Madhya and the centre of the descendant-7th house), or declining Moon in day time be in the visible half (ie. between the centres of the descendant and the ascendant), even results will be felt in respect of fear, grief etc. (That is. these positions confer bad results). The Full Moon gives kingdom, if she be contrarily posited. Notes: The Full Moon in the case of day birth in the invisible half and ia the case of night birth in the visible half confers kingdom, wragraaded: a: aaaagaa EUTT I neq @aremag 0 aexrafa aA RR 32. DHANA YOGAS: If all benefics are posited in upachayas ie, 3 6 10 and 11 the native will acquire much wealth. Two benefics coafer moderate wealth while one confers little wealth in the said upachaya. These can be deduced from the Moon also. afetredisastt Raista a atfaat: 1 quate aad fg set ada avaaT naan ## Page 164 160 Saravali 33. There are other Raja yogas like Adhi yoga arising from the Moon. I have not dealt with them here which I have done infra, Notes: The other yogas, namely Adhi yoga etc. are still superior that are capable of conferring high status on the native. The yogas like Sunapha, Anapha and Durudhura are not comparable to such kingly combinations but are only moderate, fa searuaifacfaarat areracat aera) ara paleaseara: 183i! Thus ends the 13th chapter entitled “Yogas from the Moon’? in Kalyana Varma’s Saravali. ay qaaTeaT: uy etl Chapter 14 —_Yogas from the Sun qaisaatatfatstateasatnaa fa: 3 suafeaaageraadl «arma: Naa gn 1, VASI, WESI, UBHAYACHARI YOGAS FROM THE SUN: Excluding the Moon (and nodes) a planet in the 12th from the Sua causes Vasi yoga, in the 2nd Vesi yoga and in both the 12th and the 2nd Ubhayachari yoga. ween feared oieqaiferd aateiaga waafs aaafaafed frre aa gee RN 2. RESULTS OF VESI YOGA: One born in Vesi Yoga will be weak-sighted, firm in his word, be hard working and will have a bent body. So say Yavanas. Notes: Sage Parasara observes in his Brihat Parasara Hora Sastra (ch, 38) that such a native will have even sight, ## Page 165 Chapter 14 161 be of truthful disposition, has a long body, will be indolent, be happy but not be much wealthy. Phala Deepika distinguishes these yogas caused by bene- fics as Subha Vesi, Subha Vasi and Subhobhayachari; and by malefics as Papa Vesi, Papa Vasi and Papobhayachari. The adjectives themselves are suggestive. The ones, so to say, by benefics cause good results while the ones by malefics give adverse effects, aadaafarageaat aye waft ara: we: ardifeat agiel wat tert ua afemiat afeat gefadtat ge amerea | aviag: ferfagt oqitvarey att Aait en aearewarast |= qgrare: «at dat wang: aadt oar afm mavat un 3-5, EFFECTS OF VESI YOGA CAUSED BY DIFFE- RENT PLANETS : Should Jupiter cause Vesi Yoga, the native will accumulate money, be learned and be good-hearted. If Venus produces this yoga, the person will be timid, will face obstacles in his missions, will have pleasant (or swift) movements and will be defeated. Mercurial participation indicates that the native will be a servant (afea#ay), will suffer penury, be soft-spoken and be modest. He will be bashful. Mars denotes that the native will resort to base means (4rt#¥), but be helpful to others. If it is Saturn that causes Vesi yoga, one will join others’ wives, be wicked, will resemble an old person in appearance, be fraudulent in disposi- tion and be contemptuous, He will, however, have wealth. saqeara: epfeargatrgal feted fig 1 gaat gaat asfear: arfaat arat ign 6. EFFECTS OF VASI YOGA: One born in Vasi yoga will possess excellent speech (voice), good memory, be employed, will have looks towards sideways, will possess 1. @y@pr may also indicate ‘mean behavior’, ## Page 166 162 Saravali a’ strong physique above the waist, will be equal to a king and be a genuine person. Note: Satwika has several meanings thus : genuine, virtuous, amiable, ‘vigorous, good, real etc. afaaragfeqadt wafa get arfiee aaaare: Ae waral Geary amemth ara gaa: now faawret vfaxagateat eatgatat aerasq 1 veme -faenat yfrad asa uct afer, aataua: TATATAAT ITH: | qeaat gffeat oad arity aivat nen 1-9.° EFFECTS OF “VASI YOGA BY DIFFERENT PLANETS : If Jupiter should cause Vasi yoga, the native will possess courage, strength and wisdom. He will keep up his word. Inthe case of Venus,”the’ person will be valorous, famous, virtuous 'and reputed. ' Mercury emanating ‘this yoga will make one speak sweetly, beautiful’ and obey others’ orders. The Vasi yoga caused by “Mars indicates that the subject will be victorious in war, famous and will live’ with his own fortunes, If by Saturn, the native’ will be a business- man, wicked, will steal others’ money, will hate elders and will be the husband of a pious lady. aden aed agai ara area ueimagerg oad Ge | aarfeserT: uot 10. The strength of’the ‘planet Sun and that of the planets causing these yogas and their association with various Rasis and Amsas should beunderstood and all results be declared accordingly. edag: wae: amare: afeadt. fagraed t arqza: ofegat faatasat waguaaaiq gen 1. gfaferatl is also a reading in some versions which means ; shameless ## Page 167

ll. EFFECTS OF UBHAYACHARI YOGA : One born under Ubhayachari yoga will have forebearance, will be very fortunate (qyz), even bodied, firm, profoundly strong, not very tall, full of everything, learned, happy, will have many servants, will protect his relatives, be equal toa king, ever enthusiastic, and_ will enjoy all pleasures. aa agyaaat aqararsat qsfeaea: 1 freateerat eet yest | derguaaaty new afer weareeifactearat areraeat qaatay arr aqeeiisera: 2¥i ‘Thus ends the 14th chapter entitled “‘Yogas from the Sun” in Kalyana Varma’s Saravali. ay fearaieara: uy

mamaria gigvamlag vend Tay) wagaygia wearagat aed fataa un 1, INTRODUCTION TO TWO-PLANETARY YOGAS : Vriddha Yavanas have stated the effects of combinations of two planets (in one house). I state those below sans ego. (%o Mo)gaatat at: earefarta: gefaeagafae: | maaeaagaat = wegeret: fearfaga: ua 2. SUN-MOON YOGA : One who has the Sun and Moon together will be at the disposal of his wife (or females), immo- dest, be a metallurgist (¢zfaq can be interpreted also as “able to deceive”), will be quite wealthy, and be an expert in sale of intoxicants. Notes ; Should these two be together, the native’s wife will have an upper hand. He will be an expert machinist, will have affected eye sight and will suffer eye diseases. This com- ## Page 168 164 ‘Saravali bination makes one an expert, immodest and light-hearted. He may take things casually. According to Jatakabharana, with this combination, the native will be skilful in poison, machinery, selling and buying, be capable of making fictitious articles, be very libidi- nous, and honourable. (Xo Ho) wmedt erefaal gat aracregatsTaaTy | cranfatafaeat cage: cag TaTSTT RN 3. SUN-MARS YOGA : Should the Sun and Mars be in one house the native will be splendorous, valorous, dull- witted, strong, be a liar, be sinful, disposed to kill (or torture) and be fierce. Notes : This combination makes one a liar, foolish and strong. The native may be engaged in Defence, police service etc. According to Jatakabharana, this combination makes one very splendorous, stiong, foolish, very emotional and valorous. (%o Go)Rargafearant cfaaat: fraaat gata: eaTq 1 ara: fafaafaefaa: ant a aaeafeataarary wen 4. SUN-MERCURY YOGA: If the Sun and Mereury are in one house, the native will be in service, will have unsteady wealth, be sweet in speech, will have fame and moncy, be noble, dear to king and good people and will possess strength, beauty and learning. Notes : The Sun and Mercury together make one learned, gentle, honourable and famous. This conjunction goes in the name of Budhaditya yoga. Jataka Martanda is however of the view that this Raja yoga is effective only for Leo, Aries and Virgo but not for other ascendants. Such people can easily attain fame in life. Jatakabharana states that one with the Sun and Mercury yoga will be an eloquent speaker, bea king's minister, will carn money through service, and be skilful in arts and Vedas. ## Page 169 Chapter 15 165 (to go)agant q39faa: gqgfoara faded: 1 qi ageafagh— wagaremadaeaz nun 5. SUN-JUPITER YOGA : If the Sun and Jupiter be together, one will be virtuous, be a minister of king, will gain through friends, be with good mind? and be a preceptor. Notes : The conjunction of Jupiter and the Sun is favourable for those pursuing teaching profession. This yoga makes one wealthy and very famous. One becomes spiritual if these are well-placed being together. As per the statement of Jatakabharana, one with this yoga will live by Purohitya (performing religious rites of various families as laid down in Sastras), be a king’s minister, will gain wealth through friends, be wealthy, helpful to others and skilful. (%o Qo)neangrufaarafeag — Aagdarae wma ocfafeadt: « ettagrencrageer: neu 6. SUN-VENUS YOGA : If the Sun and Venus be toge- ther, one will be skilful in use of weapons, be mighty, weak- sighted in old age, will be able to amuse the public and will have abundant money earned through women. Notes: The Sun and Venus affect eye sight. One with this combination is highly libidinous. If Venus is ahead of the Sun in longitude, then the former is very favourable in general matters. Vide Jatakabharana, the native with the yoga of the Sun and Venus will be interested in music, archery etc., be weak- sighted and be happy in regard to wife and friends. (Xo Mo) aga aT: KAMA PATA: TUBTARTE: fama: ge: afacedteraitara nou 7. SUN-SATURN YOGA: If the Sun and Saturn are together, the native will bea metallurgist, be virtuous, mind- 1. wafentq is another reading which means : plentiful. ## Page 170 166 Saravali ful of his owa duties, will lose his wife and son, will have the qualities suitable to his race, will be pure but not so up- right. Notes : One becomes learned with this combination. He is very mature in behaviour as an elderly person but however will be disadvantageously placed in family front, if these two are adversely placed in the 6th/8th/12th According to Jatakabharana, one with the Sun-Saturn combination will be skilful in sale of minerals, be virtuous, will possess good qualities, be happy with wife and sons and be wealthy. (Ho Hoye TRA REMsaaaaTAagTA aeaderg het FEMA _AT ict 8. MOON-MARS YOGA : One who has the Moon and Mars together, will be valorous, brave in war, bea boxer, will suffer bloody imbalances or diseases, will manufacture articles of mud, skin and minerals and will be an artisan and a metallurgist. Notes : This is not a good position for maternal relation- ship. This combination often throws heavy afliction to blood. This is favourable for pottermen, skin dealers and leather dealers, business in minerals etc. One can achieve proficiency in boxing, with the help of this combination apart from riches. According to Jatakabharana, this combination makes one bereft of conduct, mean-minded, valorous, business-man, belli- gerent, inimical to mother and sick. (Ho go) areanarealaiaga: aaa: eine: gears | feraaat: afagaitiiefa: carfefgga: nen 9. MOON-MERCURY YOGA : One who has the Moon- Mercury combination will be expert in poems and fables, be wealthy, amiable to his wife, beautiful, smiling-faced and. will be endowed with distinct virtues. ## Page 171 Chapter 15 i67 Notes: Mercury and the Moon together cause fame and honour through women, literary success etc. This can however weaken one’s virility. Jatakabharana states that the native who has Moon and Mercury together at birth will be an eloquent speaker, rich, beautiful, kind, modest, affectionate to wife and religious. (#o Ho) geatgal fara: eaargdarasaaaea 1 afaedl: gaata: gefsarat feat wages: ugon 10. JUPITER-MOON YOGA : One with Jupiter and the Moon together will be firm in friendship, modest, respectful t owards his relatives, wealthy, virtuous and regardful of Gods and the wise. Notes : The Moon-Jupiter yoga gives great intelligence and female children. The native will be broad-minded and wealthy. Should this conjunction occur in the 10th, the Moon simultaneously being waxing,. the subject will attain high state in life. Vide Jatakabharana, if these two planets are together at birth, the native will be modest, be attached to his duties and helpful to others. (@o Qo)amearracgaa: fearfafaa: gafratseaaa: 1 wafaatg gua: afrartadt: gar at ueen 11. MOON-VENUS YOGA : Should the Moon and Venus be together, the native will be endowed with flowers. incense and clothes, will know to perform duties (fat also means rites), be dear to his race, very lazy and expert in buying and selling. Notes : This combination gives fighting tendency accor- ding to Kasinatha, author of Lagna Chandrika, According to Jatakabharana one will deal with textiles, will have vices, be of good conduct, and will like good clothes cto, if this yoga is present at birth, ## Page 172 168 Saravali (Ho Mo) STATAT ABTEaaeaTAR ‘arate: 1 aamt fear: gaa: qerfsa: caregargahMny ugg 12, MOON-SATURN YOGA : Should the Moon and Saturn be together, the native will possess a decayed wife, be dear to public, will breed clephants and horses, be deviod of virtues, be under the control of others, unwealthy and defeated. Notes : These two together promote tendency o f seeking “sexual pleasures with aged women. The native’s wife may be elder than him. If found in woman's horoscope, widowhood will follow. Vide Jatakabharana, the Moon-Saturn company will make one attend upon many women, attached to whores, be of bad conduct, born of others’ loins and unwealthy. (Ho go)eatgimsetfan: gavteterarer: carta: 1 geedfaaarmi gaugedtttaafearfaga: nan 13. MARS-MERCURY YOGA: If Mars and Mercury are together at birth, the native will have unlucky wife, little wealth, will work with gold and iron, be an architect, will keep a wicked widow and be expert in making medicines. Notes : zqqfa means a king, architect, master-carpenter, women’s attendant, Kubera etc. But, as Mercury rules archi- tects, the proper interpretation is architect. It is not however wrong to apply the various meanings as above, except “Kubera”” denoting wealth. Mars-Mercury conjunction promotes thieving disposition The native will well pursue jobs related to gold, metals etc. Good salesmanship will follow this combination, but however it is unfortunate for marital bliss. According to Jatakabharana, the native with Mercury- Mars conjunction will be an expert in boxing, be attached to females, will deal with medicines, and will produce golden and steel articles. ## Page 173 Chapter 15 169 (Ho Jo)frerafaateaat Rardt afiaaneat afrarqs mera: gyyegaa: | warraat: ues 14. MARS-JUPITER YOGA : If Mars and Jupiter be together at birth, the native will be an artisan, vedic expert, intelligent, expert in speech, wise and fond of using weapons. Notes : One with this yoga will be skilful in Sastras and Mantras, wise, be an army chief, king or the head ofa town or village, as per Jatakabharana, (Ho Yo)gsat terrarat ahaa: Tegafaeit cat ae: | garqarsa faera — faafarzaatt ngun 25. MARS-VENUS YOGA : One who had Mars and Venus together at birth will be worshipped, be chief among his men, bea mathematician (or an astrologer), and be fond of gambling, untruth etc. Notes: Mars and Venus in conjunction show unhappy sign in marital front. The native may seek extra-marital relationship unless well-aspected by other favourable planets. Diseases of vagina or penis will result from this yoga. According to Jatakabharana, with these two planets toge- ther, one will enjoy many women, will gamble, be a liar, be honourable and be inimical to all. (Ho Mo)atkemmagra: saSaRaHdHATe | guateaiaadt: western: sferefa: cag nee 16. MARS-SATURN YOGA : If Mars and Saturn be together, one will bea metallurgist, be expert in jugglery, be deceitful, skilful in thieving, troubled by weapons and poison and be fond of quarrels. Notes : The native with this yoga will make weapons etc., be a skilful warrior, robber, liar and be unhappy, vide Jatakabharana. (Jo Jo)Tafaafaarat statsis a Raarafaage: | gayent afearq ateagal sraasaray ugow ## Page 174 170 Saravali 17. MERCURY-JUPITER YOGA : One who has Mercury and Jupiter together will be a noted dancer, scholar, singer and instrumentalist. He will be wise and happy. Notes: According to Jatakabharana, the native with this yoga will have knowledge of music, be a justice, be modest, very beautiful, courageous, liberal and foud of scents. (gogo)afanaaat arat aghrett Aafaegaraa: eaTg | atest gravadataaadtironrereta: usu 18. MERCURY-VENUS YOGA: Should Mercury and Venus be together at birth, the native will be abundantly rich, a politician, an artisan, will study Vedas, be good in speech, will know to sing, make fun and like sceats and flowers. Notes : According to Jatakabharana one, with this yoga will be supreme in his descent, be sweet in speech, be delighted, will maintain many people, be virtuous and wise. (go Mo) aA THAT: VISA: cewlatAAMT: | faga: Maaaradt gaat gary wale ugen 19. MERCURY-SATURN YOGA : One who has Mercury and Saturn together at birth, will contract debts, be proud, deceiving, an able poet, intent on moving, expert and will possess auspicious speech. Notes : According to Jatakabharana, one with this yoga will be fickle-minded, fond of quarrels, skilful in arts, and will maintain many. (go go)stafa faarardfafaezeadfearat sATTga: stafaaatigedt § fafezaret | waa frATT Rot 20. JUPITER-VENUS YOGA : One who has Jupiter and Venus together at birth, will live by education and arguments, will follow a highly virtuous path, will have accurate conception or notion (of things), and will have a supreme wife. Notes : Vide Jatakabharana, one with this yoga will be learned in many branches, will argue even with scholars and be happy with friends, sons and wealth. ## Page 175 Chapter 15 ivi (qo ao)ga asa anerfaafedaedt a1 afastamt: sara: afqrerararrdtararg ue 21. JUPITER-SATURN YOGA : A native who has Jupiter and Saturn together: at birth will be heroic, will have plenty of wealth, will be chief of the city (mayor etc.), famous, and will be the head of an assembly, a village or an association. Notes : This combination is congenial for political posi- tions, like assembly speakers, village heads, mayors etc. as well as heads of associations etc. Such people are also found as successful doctors and advocates. Jatakabharana bas almost similar views as of Kalyana Varma, but adds that the native will achieve his aims. (Jo Mo)arefaareaaa: avfeararenifredt a1 werent: agate: afafeatt garg waft ean 22. VENUS-SATURN YOGA : If Venus and Saturn are together at birth, one will be expert in breaking wood, bea barbour, painter, or sculptor, boxer, be intent on wandering and be owner of quadrupeds. Notes : If these two are strong in a good house, one will take to good professions described above, viz. painting, boxing etc. Should they be weak, the native will resort to mean pro- fessions, viz., barbour, wood-breaking etc. set we TTANT TerMearanfean: | auafefarcta gdf fasta aur neg 23 Whatever results have been stated as above are likely to become increased or decreased according to mutual good or bad vargas occupied by the planets in question. afe scaruadfacfaarat arcracat feagatit ara Teaaeileara: 12MI! Thus ends the 15th chapter entitled “Conjunction of two planets” in Kalyana Varma’s Saravali. ## Page 176 172 Saravali ay aegis: eau Chapter 16 Conjunctions of 3 Planets fade: creed) gare: TART YT afaafrarg gaa: agiead: qaafraht: nen 1, SUN-MOON-MARS YOGA : Should the Sun, the Moon and Mars be together at birth, the native will be bereft of shame, be sinful, will have knowledge of machinery, will destroy enemies, be brave, and will be expert in any kind of work. Notes : The yoga of Sun-Moon and Mars in combination will promote the ability to produce machinery, spurious articles ete. This can also cause seminal defects. The native will be hard of progeny. awed faguafe: areanarnitomaca: 1 aupemeet ett cfeerfarfarst: aged: wen 2. SUN-MOON-MERCURY YOGA: If the Sun, Moon and Mercury are together, the native will be splendorous, very intelligent, will be fond of arts, assembly and drinks, be in royal service and bold. Notes : The native with this yoga will do well to take up government jobs or agencies from government. This is congenial for political success, literary pursuits and achieving wealth. wat aratfaga: Fargas fataaaca: 1 Bart oaaeafa: — agfeadeaiarfareta: nan 3. SUN-MOON-JUPITER YOGA : Should the Sun, Moon and Jupiter be in one house, the native will be given to anger, be cunning, expert in service, intent on going to foreign places, be intelligent and fickleminded. Notes : These three planets together can make one pious; affectionate to relatives, a minister and firm in disposition. He ## Page 177 Chapter 16 173 is more cunning than sincere. He is fickleminded, learned and skilful in his profession. aeteet fag: warezara TeafgUTa | vfaranaeagea teeaaiaa Ag: wen 4, SUN-MOON-VENUS YOGA : Should the Sun, Moon and Venus be in one house at birth, the native will steal others’ money, will be a debaucher and be expert in Sastras. Notes : The combination under discussion can give thiev- ing tendency, vices (particularly immoral nature) and aversion to good acts. The native will be prone to dental diseases or may have unsightly teeth. He may not get on well with his mother. The marriage may be a delayed one. It gives physical beauty if undisturbed by Saturn or a node, This isa good position to win over the enemies. art faaragaet qa: Tearat afeara qifrmacciaateeaaiad Fa wan 5. SUN-MOON-SATURN YOGA : If the Sun, Moon and Saturn be together in one house, the native will be lustful, be expert in arguments, be a dunce, be at the disposal of others and be poor. Notes : The combination as above is good for legal pro- fession, If these are not well-aspected, poverty will result. The native will be quite libidinous and be not virtuous. Horse- breeders will do well with this yoga, Metallurgists can also look forward to good position. In all, this yoga causes many general failures in one’s undertnkings. wafa earal aes: argent freee fares: 1 aaganaaciga: agheaaeagaated: ug 6. SUN-MARS-MERCURY YOGA: If the Sun, Mars and Mercury are in one house at birth, the native will be famous, hard-hearted, shameless znd be devoid of wealth, sons and wife, ## Page 178 174 \Saravali Notes : This combination may have more telling effects on the marital life than on the question of children, If it occurs in the 7th house, marriage is very adverse. Success in money matters is very limited. If, however, the influence of Mars is less in this yoga, the native will be learned and wealthy. aafe fagat agri: ferfacfereat a arfratsfr aera: wavs: agkadvitaqega: won 7. SUN-JUPITER-MARS YOGA : Should Mars, Jupiter and the Sun be together at birth, the native will be an expert speaker, very wealthy, either a king's minister or even a king himself, be truthful and fierce. Notes: These planets together at birth can make the person easily and highly irritable. Thenative will be a gifted speaker and be skilful in work and can hope to reach high position in life depending upon the house of the conjunction, For example, in the 10th, this yoga can produce parliament: rians, political stars, judges, army heads etc. Shoud the Rasi involved be Cancer or Capricorn or Libra as ‘the 10th (where one of these will be in fall) the native though can acquire prosperous position, is not free from downfall. AAAGT: HT: GAM araaerdga AGA: 1 woitizaaart: aged: enfewagar: uct 8, VENUS-MARS-SUN YOGA: One who has Venus, Mars and the Sun in one house, will be subjected to eye diseases, belongs to a good race, will be fortunate, harsh and wealthy. Notes : The native with this combination will be more materialstic and sensuous. He is prone to eye diseases. (Parti- cularly, the ascendant with this trio can deprive one of eye- sight.) He does not speak much but harshly and ably. This is a good position for intelligence of high order and for achieve- ments in movie line, photo studios, music etc. ## Page 179 Chapter 16 aY75 fasargt aacigat fred Crfaat aga: 1 wrmacigaislaged: ferfaoraicrargia: afd: ven 9. MARS-SUN-SATURN YOGA : Should: Mars, Saturn and the Sun be together, the native will have deformed limbs, be without wealth, always sick, without his people and be a big fool. Notes : This yoga deprives one of his father and relatives. He cannot earn much wealth. He will be devoid of wisdom. Deformation of limb will depend on the house involved. (For example, if they join in the 3rd, hearing defect can be pre- dicted) The native will suffer from many diseases and litiga- tions if they join in a house other than the 6th. Aargtistrarary areaHarETerAt efter: | aractfagaga tara fain: JE NU 10. JUPITER-MERCURY-SUN YOGA : If Jupiter, Mercury and the Sun be together at birth, the native will be subjected to eye-discases, be very wealthy, be interested in Sasthras, fables, poetry, meetings and stonework and will become a good writer. Notes : Should the conjunction occur in the 3rd in particular, one can achieve success in writing books, publishing, book-sales etc. It the Sun is not more powerful than the other two, the yoga in the 3rd can bless one with mellifluous voice. afaqet ararét wauefa: sitftat qefa: 1 eae: eae: afgacfaania: alge: ugen 1. MERCURY-SUN-VENUS YOGA : If Mercury, Sun and Venus be together, the native will be insatiable, talkative, intent on wandering, and subjected to grief on account of women. Notes : If they join in the 7th, other than in Libra or Taurus, the marital front will be greatly disturbed. In Libra, if the Sun is predominantly strong in Shadbala it may even deny ‘marriage, ## Page 180 176 Saravali aclararet goa: aafaat aeqia: afta: 1 vaherfetrgga tariaiaa Fer: AU 12. ‘SATURN-SUN-MERCURY YOGA: One who has Saturn, the Sun and Mercury in one house will be a neuter, will hate others, aud will be given up by his relatives, Notes : This yoga will tell upon the virility of the person. Particularly in the Ascendant, these can make one look like a eunuch. This is an adverse combination for paternal affinity. The native will house many vices and will incur enmity with others without any reason. He will be a loser in litigations. He will always be in the company of bad people. gama: Ye: sta feara qa: afar: 1 aeardeal fred antaqenrent: afga: neg 13, VENUS-JUPITER-SUN YOGA: Should Venus, Jupiter and the Sun be together at birth, the native will be weak-sighted, bold, intelligent, indigent, be a minister and be devoted to others? jobs. Notes: JATAKBHARANA declares that this is not a good yoga for money just as Kalyana Varma does. In our opinion, this combination, can give abundant riches, if none of of them is weak in the horoscope. According to HORASARA, one will be a king with this yoga, but will lose in gambling etc. WAHT: Yea: TAMARA: Araregalea aneteel farawat sitaréafaret: afga: ugen 14. JUPITER-SATURN-SUN YOGA : If Jupiter, Saturn and the Sun be together at birth, the native will not have a prominent physique, will be worshipped, will hateh is own men will have good wife, children and friends, be dear to the king and be fearless. Notes : One with this combination will have reasonable expenses, be honoured by all end will hold a prominent posi- ## Page 181 Chapter 16 177 tion. He will play to the tunes of his spouse according to MANASAGARI. aaraaem AaBarateaateal AGH: | gkaraie: gt faenfeciadgeiafs ueun 15. VENUS-SATURN-SUN YOGA : One who has Venus, Saturn and the Sun together at birth will be emotionally upset due to fear from enemies, will be devoid of honour and know- ledge of arts and ‘poetry, will have a mean history and will suffer from leprosy. Notes: He will be a cheat of first order. His life will be miserable, He will be sick but will acquire some money in his old age. (HORASARA, p. 282). Notes : This yoga will affect the married life of the native, The native will suffer from cardiac defects. STH: ATA ATATATRT: | YREEAHARTAT: | aeiersa ger: Targgegias: afgat: ren 16. MOON-MERCURY-MARS YOGA : Should the Moon Mercury and Mars be together at birth, the native will be sinful, mean in habits and conduct, and devoid of friends and relatives throughout life. Notes : He will not have wealth according to JATAKA- BHARANA. Vide HORASARA, p. 282, the native will attain fame, be honoured by the public, be learned, be eloquent in speech and kind. Prithuyasas adds that the native will be penniless in the middle of his life. foray: estes: arara daa: TAIT) aharargg tea eeararstles gen 17. MARS-MOON-JUPITER YOGA: A native who has Mars, the Moon and Jupiter together at birth will have an even body, be addicted to women, be a thief, be splendoroug, dear to women and given to anger. ## Page 182 178 Saravali . Notes : According to MANASAGARI, the native’s face will be equal to that of Moon, see 4x gra Ya wag 1 This combination can leave wounds and marks on the tody and make one short-tempered. gator: ga: vfaea vem: aaa fafaee: 1 gaatafat: afgtauefa: ates ngs 18. MARS-VENUS-MOON YOGA : One who has Mars, Venus and the Moon together at birth is the son of a bad woman and also will wed such a lady. He will be of wandering disposition and will have fear from cold. The native will be susceptible to afflictions from colds. Both Mansagari and Jatakabharana also state that the native’s mother will have bad history and the subject will marry a bad female. Venus in conjunction with Mars affects the wife while Mars afflicting the Moon causes adversity in regard to mother. area gasadte aml faaasa clefefase: 1 waa a a qgaarfenrremegarary nent 19. MARS-MOON-SATURN : If Mars, Moon and Saturn join at birth, the person concerned will lose his mother in boy- hood, be mean, wicked and inimical to people. Notes: The relationship of Moon with the said two malefics can deprive of mother in boyhood itself. The native will be ever fond of promoting quarrels. saareeat areal aaeat earfrary fagaatte: 1 aera gat gargaeginadad: uzon 20. MERCURY-MOON-JUPITER YOGA : Should Mercury, Moon and Jupiter be togother, the native will be wealthy, skilful, eloquent in speech, bright, famous and will have many sons and brothers. Notes ; These three in conjunction confer good conduct, ## Page 183 Chapter 16 179 wealth, friends, wisdom and scholarship, according to JATAKA- BHARANA. This is an advantageous position to achieve a high degree of success in astrology. facrdepenfacia dtarare: gareaaoaa: 1 Real aangedt qaaTiaaeaaay uy 21, MERCURY-VENUS:MOON YOGA: One who has Mercury, Venus and Moon together at birth, will be mean in conduct in spite of his being learned and cultured, be jealous and miserly. Notes: According to MANASAGARI, he will also be blameworthy. This is not a good position for smooth relation- ship in the family, The native will be too much attached to money. wearasat fawa: stat arett gyfira: fafa 1 wafe ae: dat alegeerrggareng wn 22, SATURN-MOON-MERCURY YOGA: If Saturn, Moon and Mercury be together, the person concerned will be dependent, deformed, learned, be an able speaker and respected by the king. Notes : One with this combination will be famous, skilful in many arts, be head of a village or town and be dear to king, vide JATAKABHARANA. The conjunction of Saturn-Mercury and the Moon can promote cardiac and asthmatic problems. It is more so if it directly relates to the 6th house. aredtana: srt: wereafaa aga: ary: 1 wntaqeafatt sma: gaat | waegem: naan 23, VENUS-JUPITER-MOON YOGA : Should Venus, Jupiter and the Moon be in one house at birth, the native will be a chaste woman’s son, be a scholar, will have knowledge of arts and many Sasthras, be virtuous and beautiful. ## Page 184 180 ‘Saravali Notes : This conjunction can give wealth of high order if related to 2nd, 1Ith or 10th house. One can hope to achieve literary success with these 3 planets being together at birth. areariacagiad senaqay farrearate: 1 afraractfadttaraatageacta: usu 24, MOON-JUPITER-SATURN YOGA: One who has Moon, Jupiter and Saturn combination at birth will know the inner meanings of Sasthras, will seek union with aged women, be devoid of shame and be the head of a village and people. Notes: The native will yield to his wife, according to MANASAGARI. One will be addicted to women of higher age bracket as Saturn partakes in this yoga. fafaaegemarangaaai vate at gear aafaat qaearati afiranigaticaatt wan 25. MOON-VENUS-SATURN YOGA: If the Moon, Venus and Saturn are in combination at birth, one will be a writer, reader of books, Purohit (family guru), will have to his credit merits of past birth, and be an astrologer. Notes : Should these 3 planets be together at birth, one will go after women, will have a bad married life or may lose his spouse early. gafa: etatara: aeafaafa: coed seat: amaaaegaat: «= earggaaeqaa: «alga: nee 26. MERCURY-JUPITER-MARS YOGA : One who has Mercury, Jupiter and Mars together will be a good poet, lord of a group, will marry a virtuous lady, be intent on helping others, and an expert singer. aga fawargearat gpeq wae Aga: 1 gavt fratkarat gugaagaed: alga: uzout 21. MARS-MERCURY-VENUS YOGA: Should Mars, Mercury and Venus be together at birth, the native will ## Page 185 Chapter 16 181 give up his caste, be deformed, fickle-minded, wicked, and- garrulous. Seq: waraaaa: sataaitel wageaehit wa oo ogaraitetqarfwefiee: § agwed: uci 28. MERCURY-SATURN-MARS YOGA : Should Mercury, Saturn and Mars be together at birth, one will be a servant, will have dark eyes, be intent on living in foreign places, will have facial diseases and will be witty. aceite: acqaara faanfacter: aaraageter: | aRaaarreet =| abtaqeyfast: = afga: wren 29. VENUS-JUPITER-MARS YOGA : One who has Venus, Jupiter and Mars together at birth will be dear to king, will have good sons and enjoy pleasures through women. He will please all persons. aqdaa: etargy atararet faafgat fa: wafa avl fanaaa: 9 qtsagaatfeadmt won 30. JUPITER-MARS-SATURN YOGA : If Jupiter, Mars and Saturn be together at birth, the native will be honoured by the king, will have wounds on the body, be mean and blamed by friends He will also be unkind. gateafagiarar: gat wat waeqafagts: 1 fred osatasita: «aged: atfegorga: naan 31. SATURN-MARS-VENUS YOGA: If Saturn, Mars and Venus are in one house at birth, the native is born to an immoral lady, will marry such a lady will be devoid of happiness, and will be intent on wandering in distant places. gag: afrarferat qafa: gurecat qysatia: | gayvga: afgddafe oat: | aemaaATa RIN 32. MERCURY-JUPITER-VENUS: Should Mercury, Jupiter and Venus be together, the native will have good physi- ## Page 186 182 Saravali que, be successful over his enemies bea king, fortunate, widely famous and truthfully disposed. miaeteadgd ost | agutfitd eqarexay) gfadteagd gui saat garfisttarer: aan 33, MERCURY-SATURN-JUPITER : When Mercury, Saturn and Jupiter are together at birth, it denotes that the native will enjoy honour, wealth and sovereignty, be learned, will have abundant pleasures, be atttached to his wife, be courageous and fortunate, gart adisqaary oegafredt vafzaraite: 1 gagegiaat: = waeafaa: TARTLA: UI 34, MERCURY VENUS-SATURN : One who has Mercury, Venus and Saturn together at birth will be scurrilous in speech, fraudulent, be a liar, addicted to other women, vehement, (faq has several other meanings, viz. irregular, uneven, mysterious. inaccessiable, rough, painful, troublesome etc.), will have knowledge of arts and be attached to his own country. war gash Tat wate att qafafagoantta: | yeartafeanest teed: SARET A RMN 35, JUPITER-VENUS-SATURN : Should Jupiter, Venus and Saturn be in one house at birth one will become a king even though he might be of mean natal order, will be very famous and be a respository of virtues. Notes : This is a superior combination to attain fame and high position in legal fields. agate ATgeaa: salfeersta: | qa fagerared: qa at ford ure 36. PARENTS : If the Moon is in the company of male- fics, it is detrimental to the mother of the native, Predict ## Page 187 Chapter 16 183 semilar results regarding the father of the native if the Sun joins malefics at birth. Benefics in the place of malefics in the said yogas will prove auspicious to the respective parent. If the planets joining be of mixed nature (i.e, one benefic and another malefic), the effects are medium, Ta: Que: aaa aagfaamfad FaAATy seuaafa age yRosaAeST esq ZOU qrareaatsta fafa: gata ae agiet Te aferagaad =oafgaed = faaadaq usu 37-38. BENEFICS IN CONJUNCTION AND MALE- FICS IN CONJUNCTION : If benefics are in conjunction at birth, the native will enjoy wealth, sovereignty and fame. Such combination produces an emperor capable of ruling the earth. Should three malefics join at birth, the native will be unlucky, indigent, grief-stricken, ugly and immodest. Notes : The combination of three benefics will produce splendid results even in the 6th and 8th—not to speak of other non-trika houses, for Adhi yoga is produced. Even in the 12th, the conjunction of 3 planets, one“of them being the 2nd lord, causes powerful monetary yoga, (see Sarvartha Chintamani). Malefics conjunct prove adverse and it is better that they are separated from eaeh other. Their concentration on one parti- cular Bhava—by way of conjunction—proves severely inauspi- cious for that particular house while their separation distributes the imbalances evenly. ofa weargatfacfaatat areracat faagatal are area sema: EI Thus ends the 16th Chapter entitled “3 planets in combi nation” in Kalyana Varma'’s Saravali. ## Page 188 184 Saravali BT AHA: Bo Ul

Chapter 17 Four Planets in Conjunction fafeacaenegey tit ATaTTISaReTS t gacfadtanarg teeta: - gy wafer ue 1, SUN-MOON-MARS-MERCURY YOGA : Should these four planets be together at birth, the native will bea writer, a thief and be scurrilous in speech. He will be sickly, cunning and be capable of deceiving others. amar afrararaeamedt atfrary faraate: | siarat fagu: afiguyearent: ated: uu 2. MOON-MARS-JUPITER-SUN YOGA : One who has these four planets in one house at birth, will be wealthy, dear to women, splendorous, will maintain decorum, be free from grief and expert in work. ariifaranafa: gauge fagatsddagaaia: | faaramarga: afagenygarert: afea: wan 3. MOON-MARS-VENUS-SUN YOGA : If these four planets join at birth, one will speak and conduct himself as a great persoa, be happy, expert, intent on gathering money and will have learning, sons and wife. farnattt) Beat aaefadt arfaraat qa: 1 me: adee omar tfaafarpdticaaty awn 4, SUN-MOON-MARS-SATURN YOGA: One who has these four planets together at birth, will have uneven physique, be short in stature, be unwealthy and will collect food by begging, and be a proven dunce, alate: gare: frerett at agreit att: 1 ora: exgfarag: aftagenrent:-aiga: wan ## Page 189 Chapter 17 185 5. MOON-MERCURY-JUPITER-SUN YOGA: If these four planets are in one house, the native will be a goldsmith (ora gold dealer etc.), be long eyed, be a sculptor; be very wealthy, bold, and beautiful bodied. fama: quar arett qedt qreaat aga: 1 ata: wataed vfafngeardd: ated: un 6. SUN-MOON-MERCURY-VENUS YOGA : The native who has these four planets together at birth, will be deformed, lucky, short-statured, and dear to king. niafiafargadt aaateateataat wreraitet: 1 fraraitsaqaara — tdegatrarfafafaaay non 7. SUN-MOON-MERCURY-SATURN YOGA : If these four planets are together at birth, the native will lose his parents (in childhood), be devoid of money and happiness, be wandering, will earn food by begging and will be a liar. afaarqarceatat carat earecterarg qtfaqea: | gaagerarg trait: | GATT fage usu 8. VENUS-JUPITER-MOON YOGA : Should these planets be in one house at birth, the subject concerned will be head of water, animals and forests (i.e. his livelihood may be through such sources), will be happy, honoured by the king and be an expert. araaraedtem agaafaet aUrmaraaT: qasaaaati teeing Jee: nent 9. SUN-JUPITER-MOON-SATURN YOGA : If the said planets join at birth, the native will be dark-eyed, fierce, will have many sons, be wealthy, and fortunate through women, afaaragararz: FUACKAATTTAT: | ate ada | waaargfaarsfad: «afd: gon ## Page 190 186 Saravali 10, SUN-MOON-VENUS-SATURN YOGA: Should one have a combination of these planets in one house at birth, the native will have habits like a female, be very weak, desirous of coming up and timid at all times. qasa | aaereraset) ar faqerareaa: 1 gariatsentz: qayaeastagaals: ween 11, SUN-JUPITER-MARS-MERCURY YOGA : These four planets together at birth indicate that the subject will be brave, be a composer of Sastras (qa™Iz) or a ruler of province (waz), will lose his wife and money, be undesirable and will wander. Note : In spite of being a “ruler”, the native native may not be free from mental debacles—as indicated by the sloka. ararewaatet facargt get fanaaca: 1 waft sat gaat cfafaadttegat: afget: nean 12, SUN-VENUS-MARS-MERCURY YOGA : If these four planets be together at birth, the native will be addicted to other women, be a thief, will have uneven limbs, will be a bad person and will be bereft of energy. aiat siatedtemt arate: sfasarara neat oa yqaat «| guisiguelficdatt nga 13, MERCURY-SUN-MARS-SATRUN YOGA : If these four planets are together at birth, the subject will be a warrior, scholar, be fierce, will be meanly disposed, be chief among poets, and be a minister or a king. AAT: Teal MS saat qaraaa yla eara: 1 ciailastage teedaitfaaregas: ween 14. SUN-MARS-JUPITER-VENUS YOGA: With the conjunction of these four planets, one will be fortunate, worth worship by the people, be wealthy, dear to king and famous. aarat oo mqara: fagrat argfradqaa: | arggeaiadté: «= dgadat | aif: nga ## Page 191 Chapter 17 187 15. SUN-MARS-JUPITER-SATURN YOGA : Should these join at birth, one will be mad (2), prime among his group, will have cherished desires, will be endowed with relatives and friends and dear to king. fawat dtarart favaet ayfafig: 1 qagegratt: ced adel oarft nen 16, SUN-MARS-VENUS-SATURN YOGA : One who has these four planets together at birth, will be deformed, mean in conduct, oblique-sighted, will hate his relatives, and will always be insulted. ward ganar: fraral agaiy sweets arggastagaiata garamerfata: wget 17. SUN-MERCURY-VENUS YOGA : With these planets in one house, one will be wealthy, happy, chief, will have cherished desires, will have relatives and be noble. aeitararct aeit wagefa: aemary frecate: | aalfeqagtsd teerataa Fea: ues 18. SATURN-SUN-MECURY-JUPITER YOGA: One who has these four planets together at birth, will have a neuter’s habits, be prestigious, fond of quarrels, will have co- born, and be not enthusiastic. gat: aan: arat qgeter: acaaitadqet: 1 a fanaget «= tfaaafaracitfeaiatt zen 19. SUN-MERCURY-VENUS-SATURN YOGA : Should these four planets be in conjunction at birth, one will be scurrilous in speech, fortunate, learned, soft spoken, happy, energetic, pure, wealthy, bold and helpful to friends. gee: wf: sare: aremaratsiaaesy AlaTAaTy | aufearfafaare = tratt aa wfaB: RON 20. SUN-SATURN-VENUS-JUPITER YOGA : These four planets in conjunction at birth will make the person a miser, a poet, chief, leader of sculptors and mean. ## Page 192 188 Saravali mreagaadt ata: qrervaisa ar wgrafa: | afagraansita taeid: GATSHTA: UR 21, MOON-MARS-MERCURY-JUPITER YOGA: One who has the conjunction of these four planets at birth, will be an expert in Sasthras, be a king or a great minister and be extermely intelligent. wagefataargata: eqredatafa: quam) agen a aet afagayrarta: ated: ue 22, MOON-MARS-MERCURY-VENUS YOGA : If these four planets are together at birth, one will be fond of quarrels, will sleep much, be mean, will marry an unchaste lady, be for- tunate, will hate his relatives, and be not happy. qe fanatiaa gga ageaafirraa: | wafa qanifara: afeqerqetfcdaty ign 22, MOON-MERCURY-MARS-SATURN YOGA : One who has these four planets together will be bold, be without parents, is from an ignoble race, will have many wives, friends and sons and will have good conduct. femrerg: qara: aacagisita aTadgaa:) sat agiaaa: afgagearia: afed: ue 24, MOON-MARS-JUPITER-SATURN YOGA : If these four planets are together at birth, one will be deformed, will have a good wife, be highly tolerant, be self respected, learned will have many friends, and be happy. afatt aaarg ye: aera arvana: feaereft: t afeargarfadt wiegairacated: uN 25. MARS-MOON-SATURN-JUPITER YOGA : One who has these four planets conjunct at birth will be deaf, wealthy, bold, mad, able in speech, firm in nature, wise, and liberal, geerfa: sea: aatett fata alea: 1 wa: gedtsard | gaeganartadafa nen ## Page 193 Chapter 17 189 26. MARS-MOON-SATURN-VENUS YOGA: If these four planets are together, one will marry an uncbaste lady, will be proud, will have eyes resembling that of a snake, and will be always emotional. This is certain, fara famahtan: att aaqashquara wafa att fanariegagenfaemta: afeat: uzon 27. MERCURY-JUPITER-MOON-VENUS YOGA: One who bas thes> four planets together will be learned, be devoid of parents, good looking, wealthy, very lucky and be without enemies. pariatfacaeaaed aegaeral afar avafaa: vaala: afaqastarinta: afd: us 28, MOON-MERCURY-JUPITER-SATURN : Should these be conjunct, one will be virtuous, famous, noble and splendorous, fond of relatives, wise, be a king’s minister and be a chief poet. qeareraaaitat fasiterarat faraages i stat oo atefgg: earfegaenfnagga: wen 29, MOON-MERCURY-SATURN-VENUS YOGA: If these planets are together at birth, the native will be intent on seeking sexual pleasures with others’ wives, will have an unehaste wife, be devoid of relatives, learned and will hate people. arat vfga: aarecaratet g:faett seraraiter: 1 agamit aaa: afaqergaticfa: afedt: weon 30. MOON-JUPITER-VENUS-SATURN YOGA : The native with these four planets conjunct will be devoid of mother, be lucky, will suffer from skin diseases, will be sub- jected to grief, be intent on roaming, will know many languages and will be truthful, wateagefadaaragen ath a atteedoa: waft | garfaenagderegenia: afed: wag ## Page 194 190 Saravali 31. MERCURY-MARS-JUPITER-VENUS-YOGA : If these four planets are in one house, the subject will be fond of picking up quarrels with his wife, will be wealthy, worshipped by people, will possess good qualities and be free from sickness. Ae faa areit aaeiga: aeasitaeora: | art = aaafgoys faarafeadareqeate: wan 32. MARS-MERCURY-JUPITER-SATURN YOGA : One, who has these four planets in one house at birth, will be brave, learned, be a good speaker, be without wealth, truthful and will have good habits, He will be able to argue and endure. He will be intelligent. TaTRET: TeysE: HSAT_Y JaSHS: LATA: | waa aretddereaarta: afd: naan 33. MERCURY-MARS-SATURN-VENUS YOGA : If these four planets are together at birth, the native: will be an expert boxer, will depend on others, will have coarse body will possess pride of war, be famous and will breed dogs. asedt frags: eieta: argatiasare: | abagqegaalt eiataa fra: wasn 34. MARS-JUPITER-VENUS-SATURN YOGA: If these four planets are together at birth, the native will be splendo- rous, wealthy, addicted to other women, fond of bravery, fickle- minded, and ill-disposed. Feral areazal craraadl fdas aasitayane teieatadayt Nera 35, MERCURY-JUPITER-VENUS-SATURN YOGA : Should these be together at birth, the native will be intelligent, interested in sastras, be a debaucher and an obedient servant. fa weargadfaciaarat arcaeat agdagatn: qaeIseaa: Ugwl Thus ends the 17th chapter entitled “Effects of four planets in conjunction’ in Kalyana Varma’s Saravali. ## Page 195 Chapter 17 wr wma qq: USI

Chapter 18 Effects of Conjunction of Five Planets Ba agrasat orarfacse arfrearetz: | wafa ogamned = eabe guitare: nen 1. SUN-MOON-MARS-JUPITER-MERCURY YOGA : If these five planets are together at birth, the native will be subjected to grief, will be cunning, be bereaved of wife, and will experience physical distresses. ceadcad fedaeqaefg: gat faraaea: | adtaaifa a aed calgargaatara nan 2, SUN-MOON-MARS-VENUS-MERCURY YOGA : If these five planets join at birth, the native will be intent on doing others’ jobs, will lose his strength or courage through his relatives and friends, and will befriend a neuter. mengdaaraia «wade adgagl: 1 secrisaaten: = abcfearaea egg: wan 3, SATURN-SUN-MERCURY-MOON-MARS YOGA : Should these be conjunct at birth, the native will be short-lived, imprisoned, and be devoid of every kind of happiness, wife, sons and money. araisdt aggeat araftarat ada aaa: | wafa at face: giegqeariarara wen 4. MARS-MOON-JUPITER-VENUS-SUN YOGA Should these five planets join at birth, the native will be blind by birth, subjected to much grief, be devoid of parents, always dejected in mood and fond of singing. qague: avd: ofan: otsarit a1 fagaeaara gua: afrafagusiateatal: nxn ## Page 196 192 Saravali 5. SATURN-MOON-MARS-JUPITER-SUN YOGA : If there be a combination of these planets in one house, the native will be an expert warrior, will steal others’ money, give trouble to others, be a tale-bearer and fickle-minded. ararifawaginl afaarare: Tergarfrea: 1 qeafateed: — carfertaafngaafata: nen 6. SUN-MOON-VENUS-SATURN-MARS YOGA Should the said five planets join in one house, the native will be devoid of respect, money and prosperity, will have dirty conduct, and be addicted to women. wraat agiaval qafaat qosarray at eaTg t ema: | gaatfagat «= aaegefasttagaiea won 7. MERCURY-MOON-JUPITER-SUN-SATURN YOGA : One with the conjunction of these planets will be a machinist, will enjoy great prosperity bea king’s minister, be a judge and be famous. wre: frqaeare: dear) asaata fagea oH aerate | aaegyaqaefaga: us 8. MERCURY-MOON-JUPITER-SUN-SATURN YOGA : With these five planets in one house, the native will be timid, be deprived of people dear to him, expert in cheating, given to anger, and will depend on others for food. dat Teams aeMeatal areas: 1 earersafataet vaaraateagga: nen 9. SUN-MOON-MERCURY-SATURN-VENUS YOGA One who has the said five planets together at birth will be tall in stature, will have a hairy body, and be not endowed with happiness, money and sons. anal crafrcaraatan: cag aera afaary | agaafarcaat ARAIAPHNZFAT: gon 10. SUN-MOON-JUPITER-VENUS-SATURN YOGA One with these five planets together at birth, will indulge in ## Page 197 Chapter 18 193 jugelery, be fickle-minded, be liked by women, be learned, will have many enemies and be fearless. anit aggaat: ania: tarafafaraatter: | uafiastaamt qareefastage: ar ue 11. MERCURY-MARS-SUN-JUPITER-VENUS YOGA : If these planets join at birth, the native will be sensuous, will have a fleet of horses, will do good acts, be an army chlef, be dear to king very fortunate and free from grief. freatfaet hit fret gers TeTgTe Tat | sitinataaarar = efageraereitacfaga: ez 12, SUN-MARS-MERCU RY-JUPITER-SATURN YOGA =: Should a native have these planets conjunct, he will be emo- tional, sick, will earn food by begging geing from house to house and will live in dilapidated houses. auaaatinal fagient® agfaat wafer faeat faworerdte: gerafras gard: erg ue 13, MARS-MOON-MERCU RY-VENUS-SATU RN YOGA: One with these five planets together at birth will be troubled by wounds, imprisonment and diseases, be learned, honoured by the people, be poor and deformed. earfafreicfades: § carraptsftg-aeraca: 1 vafa afra: gee: gonfeefegwafraag: ugen 14, MARS-SATURN-SUN-VENUS-MERCURY YOGA : One with the said five planets together will be troubled by diseases and enemies, be deprived of position, subjected to much grief and will roam out of agony. Seat qa: acta afsararcisfagaat fare: 1 wafa ad caeiga: aftgeryegaciaara: new 15. MOON-MARS-JU PITER- VENUS-SATURN YOGA : If these five planets are together, one will be a messenger, a dunce, a neuter, will possess dirty habits, be very unfortunate, ## Page 198 194 Saravali deformed and bereft of money. wamaargaeaceraacatatg: gar wafers ufa: oo sfaaeat firfagaefasitafacaté: gen 16, ‘SUN-MARS-JUPITER-VENUS-SATURN YOGA : Should there be a conjunction of these five planets, at birth, one will be expert in dealing with equipment and machinery related to water, minerals, mercury and such other chemicals and will achieve some fame in these lines. agureaamiiaaiga: dadt geat a) aioe: arefere: «= qaifargagasita: ugon 17. SUN-VENUS-SATURN-MERCURY-JUPITER YOGA: One with these planets in conjunction will be learned in many Sasthras, will help friends,: be dear to clders, virtuous and merciful. alg: meat « faaraaacaateracaa: aegignt agin queggorttanygyga: nes 18, MERCURY - MOON - JUPITER - MARS - VENUS YOGA : Should these planets be in conjunction at birth, one willbe humble, free from sickness, endowed with learning, wealth, truth and happiness, be helpful to relatives and will have many friends. fafaradtt afta: cemaafrarad gar ata: 1 afaaaia aegadt gonfagestatgaioct: nen 19, MARS - SATURN - MERCURY-JUPITER-MOON YOGA : One with the conjunction of these five planets will be night-blind, penniless, dependent on others for food, [miserable and will bring discredit to his relatives. agaafaage: aerifgaafarrsite: | umedefrarrat aargqTTaya: uot 20. MERCURY - MOON - MARS - VENUS - SATURN YOGA : With these planets in conjunction, one will have a ## Page 199 Chapter 19 195 number of enemies and friends as well, be helpful to others, wicked-and highly regarded. aad atlaadl aaara: adeitngeara 1 weet oo wafe | aeeeteguaitaatfagal: ugg 21. MOON - MERCURY - VENUS-JUPITER-SATURN YOGA : If these planets are together at birth in a nativity, the subject will be a king’s minister, be equal to a king, chief of the people and be worshipped by all people. green: atanat catrafaaectt faeries: 1 famge afta: | gageargaefaga: wR 22, MARS - JUPITER - MERCURY-VENUS-SATURN YOGA : If these five planets be conjunct, the native will be good-hearted, mad (considered to be one of the 33 subordinate feelings), dear to king, free from grief, addicted to excessive sleep, and be indigent. ‘eft wearyadfacfaatat arracat Tanga ATAISETARRSEATT: ASH Thus ends the 18th Chapter, entitled “Effects of five planets in conjunction”, in Kalyana Varma’s Saravali. BT TEATATTA: gil

Chapter 19 Effects of 6 Planets in Conjunction faarrratea: ata aguraet fafagafa: 1 RATA TTA Ts YS: nant 1. MERCURY-MOON-SUN-MARS-JUPITER- VENUS YOGA : If these six planets join together, the native will be ## Page 200 196 Saravali learned, virtuous, will have an emaciated body, be acquainted with many languages, and will have distinguished knowledge. arat qeariaeaneanra fayzecasa 1 zat fame Caqamaecfat: au 2. SUN-MOON-MARS-MERCURY-JUPITER-SATURN YOGA : Should these planets be together, the native will be liberal, helpful to others, fickleminded, of satwie disposition and will gratify his sexual desires in lonely places. Sle: eareea: get eau feral Ae: 1 earns fagat 9 adeazeareafega: ugn 3. MERCURY - MOON-SUN-MARS-SATURN-VENUS YOGA : Should these six planets join in one house, the native will be a thief, be addicted to others’ women, subjected to leprosy, discarded by his own men, be a dunce, deprived of position and be issueless. ata: cepa: atin sarraraaicga: 1 fara: corgeraat fadeaceareqecfast: wen 4. VENUS - MOON - SUN-MARS-JUPITER-SATURN YOGA : If these six planets are together, the native will be mean, will do others’ jobs, suffer from tuberculosis, breathing and sneezing troubles (i.e. sneezing etc.) and_will be blamed by his relatives. weal area gum: arfagat wafer ateafcaca: 1 ana oaatidt |= talraqusitafeaate: wun 5. SUN-MOON-MERCURY-JUPITER-VENUS-SATURN YOGA : One with this six-planetary conjunction will bea king's minister, fortunate, patient and will suffer from grief. He will have no wife and wealth. aig aa wa gaia aaa vera areca qareefariaatiga: ug ## Page 201 Chapter 19 197 6. MERCURY-MARS-SATU RN-JUPITER-VENUS-SUN YOGA : Ifthe said six planets are together. the subject will always wander in shrines, be deprived of issues and wealth and will live in forests and hills. fred fa: sardt aggafacal qafxat aeat eaqadtanaga: «= gunfefeaaczaaaita: won 7. MARS-SATURN-VENUS-MOON-MERCURY-JU PI- TER YOGA: One with these six planets will be pure at all times, valorous, will seek sexual union with many women; be dear to king, be a minister and be endowed.with wealth, issues and happiness. ma afagedt qa: sersadqa fag: searaaiarate BAAAHSAT: ATE: Ut 8. PLANETARY CONJUNCTIONS : If 5 or 6 planets join at birth, normally such natives will be penniless, subjected to grief and be dullwitted. Even aspects among such planets will yield similar results according to Kandalas. Notes :In general, even if there be mutual aspeots between five or six planets, they yield unpleasant results as though they are in conjunction. The reason is most of the Bhavas inthe chartcome under adverse effect, as all plancts except the luminaries own two houses each. fa cemqadfacfaarat areraeat oeag tay araalafaetseara: tent Thus ends the 19th Chapter, entitled “Effects of six- planet combinations” in Kalyana Varma’s Saravali. ## Page 202 198 Saravali RT TASTTTATATT: URell

Chapter 20 Combinations For Renunciation aim fraraaguizdeteatargue: Bef artarary 1 werfe aararedaa: dafed aewaareatreTg ug 1. Various sages have explained widely the combinations of four or more planets producing an ascetic. Inow explain below such of the yogas. qiqgaiagaag «= qaeqdtarenrafirag 1 wakaag catered arareratfaag Fa uy 2. One born with the conjunction of the Sun, the Moon, Venus, Jupiter and Mars; or the luminaries, Mercury and Mars; or the Sun, Mars, Saturn, Mercury and Venus becomes an ascetic, gregiagiiv deuigaatnrnrgees | qareqqgarteat: eartmett: safe Ago URN 3. The native having the combination of Mars, the luminaries (i.e. the Sun and the Moon), Mercury and Jupiter; or the luminaries, Saturn, and Mercury; or the luminaries, Mars and Saturn takes to renunciation and becomes a mendicant, micagaifeangga 6 Whnararengara umatdeareaaia feaarat gafea searaa aera: su 4. The Sun, Jupiter, Saturn and Mercury being together or Mars, the Sun, Mercury and Jupiter joining denotes a mendicant faaravtarige agra: atergyangidted: gorqaritrasacr gt aad vat aaaaha aTIAT NEN ## Page 203 Chapter 20 199 5. Should Venus, the Sun, Mars and. Saturn; or Jupiter, Mars, the Sun and Saturn; or Mars, the Moon, Jupiter and Saturn with strength be in conjunction at birth, native takes to ascetism, guisdeenaared: gorisaarngaanta: | waanlarfeaaaaiadatea gat amegar ac: uu 6. One will be initiated into a religious vow if anyone of the following group of planets be found together at birth : (1) Mars, Saturn, Mercury and Jupiter; (2) Mars, Saturn, Mercury, the Sun and Venus; (3) te luminaries, Mars, “Saturn and Venus. faarcqaimastaarat: garqtasuqaraeaaa: 1 fatqgarinaargyitaaredt — aaadaraa: tot 7. One becomes a mendicant to live in forests and hilly areas if the planets group themselves in conjunction at birth as under : (1) Venus, Mars, Saturn, Jupiter and the Sun; (2) Mars, the Moon, Jupiter Mercury and Saturn; (3) Venus, Mercury, Saturn, the Moon and Mars. wRpateatet: «| Tg ga gTaiaT: | feadeatfa: algae aevar wafea amr gaalsagaaTt: ust 8, The native will become a sage, giving up (even) his food and be honoured by the people, if the heavenly bodies form conjunction as under : (1) The Moon, Mercury, Mars, Jupiter and the Sun; (2) The luminaries, Mercury, Venus and Mars. wateg dtteganitaania: cargetarieadsanress: 1 greqaifefadeaa wadaedtfe: afgaiet adit uen 9. The native will be initiated into a religious vow. if (1) the luminaries, Mars, Mercury, Jupiter and Saturn or (2) The Moon, Mars, Saturn, Mercury, Jupiter and the Sun or (3) Mars, the luminaries, Saturn, Venus and Mercury, join together at birth. ## Page 204 200 Saravali faargitarsaqaiigs: faarsstartierargatas: | WHA TATA: wat Vafer STAT yaa aatfeaa: ngon 10, A famous sage is indicated by the combination of (1) the luminaries, Jupiter, Saturn and Venus or (2) Venus, the luminaries, Jupiter, Saturn and Mercury. guraritafaariearent: faatinsitteararg is: | aasrad: afgdfaggqa aera: gearaafeaary nee 11, Note the conjunction of the following planets : (1) Mars, Mercury, Jupiter, Venus, Saturn and the Sun. (2) Venus, the luminaries, Saturn, Jupiter and Mercury. It indicates an ascetic. <ahgaritaatsata adeatram faazaaay | watagafafasrageaeanitar: eg: eageraferar: wean 12. If conjunction is found among the planetary group, viz, (1) the luminaries, Jupiter and Saturn; (2) Saturn, the luminaries and Venus; (3) Sun, Mercury, Mars and Jupiter, the native will become an ascetic living on roots and fruits, aaetaatasar AETaTTATA STAT: t uate ai oem ae aga aeReTeT TEATS gan 13, The native will become an ascetic with bark-garments if Mars, the Sun, Mercury and Venus are found together at birth. The same effect follows the conjunction of Mars, the Moon, Jupiter and Mercury. aaivagafafanagat «= qeeargaatsaate: | amet safe oem get Fafa af aTTARa TTT Ue 14. A patient ascetic (awaiting the blessings of the Supreme) is indicated by either the combination of the Moon, Mercury, Mars and Saturn or of Mercury, Mars, Jupiter and Saturn. RTH ATATAT IAT TACAT wirggafeeencras t ## Page 205 Chapter 20 201 aeqaracfafaar fad aati gata war BATIHPATATATATT WEEN 15. A sage living only by eating fruits is denoted by the combination of the luminaries, Venus and Mercury; or Mars, Mercury, Venus and Saturn; or Saturn, the Moon, Jupiter and Venus, vfaguafirgasestaaga- adefaacieare: gaetaqat: | gaaufaaad tteeiara- safe fafcadterearta: adara: nee 16. An ascetic, who will be highly honourable, living in forests, is denoted by each of the undermentioned planetary conjunctions : (1) The Sun, Mars, the Moon and Venus (2) The luminaries, Mars and Mercury (3) Jupiter, Venus, Saturn and the Sun (4) Venus, Jupiter, the Moon and Mars facafaguyenseaigadlatagege: 1 vfafagaritaiat afedfadt ata: neon 17. Find the planets together in individual groups as under (1) Venus, Moon, Mars, Jupiter and Saturn (2) the Moon, Mercury, Mars, Jupiter and Venus (3) The luminaries, Mars, Mercury and Jupiter. The result is that the ascetic will be sorrowful. guiisttsafaataga: addtremracal: 1 ae wa: eg: wactdataasizrerer aemTeTicerTs nest 18. Mars, Saturn, Jupiter, Venus and Mercury with strength, or Saturn, the Sun, Mercury, the Moon and Mars with strength in conjunction produce one with clotted hair and eae fae \ srieaaaiag arraetata- Reeitinaarfahrta ora: nee 1, Unsuccessful mendicant. ## Page 206 202 Saravali 19. The luminaries, Mercury, Mars and Venus or the luminaries, Mars, Jupiter, Venus if be together, the native certainly will become an ascetic, sasaD ferreae wfc a era: sasatar: qaaalga: etdargders: | arqaiat aaagia: segleredtat get Aattdtafa agit: aeacrearggeaig uR0tt 20. If the Sun denotes ascetism (i.e. being the strongest in the yoga), there will only be faith in the religious order while competence (to fulfil the order) will lack. If the planet, con- tributing to such order is overpowered by another planet in eclipse, planetary war etc.) the native will give up the order after being initiated into it. Should many planets denote such an order, there may be many kinds of religious orders, but these will depend on the order of the planet. sacar: tarat tfegfaaagiaetine arset: afaadter wafa a oaaarfecedar area Ren 21, If the planet indicating ascetism is combust in the Sun or is aspected by another heavenly body, the native will only have an earnest desire to be initiated into the religious order but will not attain fruition of his aim. So say Yavanas. matt ear tian dfeaa: qonfeew: wwii array | gaiet at cf eg aaiaged saat aga: uRR 22. The native will attain religious order if the Moon, posited in a decanate of Saturn, is aspected by Mars and Saturn, The same effect is produced if ihe Moon occupies the Navamsa of Aries/Scorpio in aspect to Saturn. werfat: qigaa gp: Reeg: gece gate miaiadtat get wast gataraarfa ferarcatay Ran 23. If the lord of the Moon sign receives the solus aspect of Saturn (i.e, unaspected by others than Saturn), one will ## Page 207 Chapter 20 203 enter religious order. Even in this context, the earlier yogas if present will only prevail. waufafagare: veafe atft aqga saaqi wea a arafagia: saat sregarg | gee: nen 24, If the lord of the Moon sign, bright with rays, lends his aspect to Saturn while Saturn is in an angle, the native will lose his fortunes only to enter into a religious’ order. qefgnqeatarts «= valeaeat amare at. fenareareqaia: 1 ateeneren gégte et saafe ag ora arte ger RUN 25. If one among the Sun, the - Moon and Jupiter be devoid of strength, and occupy the ascendant or the 10th or the 12th in aspect to strong Saturn, the native will become distressed ascetic, gyerraaed dherart aad faafa anacitena tateanraize Faq 1 afe farwega: weal stcadtat wafe gatatat | dtferara caer Ran 26. Should the Moon with strength be in the 10th, falling in a benefic’s Navamsa while others occupy their exaltation marks and all being in aspect to strong Saturn, the native will become the lord of the earth to only become an ascetic. aferaaagaa: ley: geri aafarigatead sae TATA afe wafa aqedt efaa: atteacdt PATTI: «—|- FRBORATATA: URott 27. If waxing Moon, with superior strength, aspects the ascendant lord, the latter being bereft of strength and being ## Page 208 204 Saravali alone (in that Rasi), the native will be devoid of wealth and ‘Own men, be miserable, sorrowful, will take to ascetism and will obtain his food with great inconvenience. atfe: guartes: cafe aa agiertarears | graitg ora waafe dtarfad gery nest 28. One will become a religious mendicant if Satur occupying a benefic’s navamsa aspects others including the Moon. The Moon in this case should only be in Aquarius Navamsa. umena: aastenfiafatattiaat = ger den aearasd wait gered: faery ue 29. Ifthe lord of the Moon sign aspects all the other planets, while these are all together in one Rasi, the native will become an ascetic. aritat ofearear firfeadterera arcat: qaterraaeret aaaeiaat garated 3 Taal wat aa frafaat agifrearfaat atarcaatregaralariaetat mat WERT: UZ0N 30. The Sun rules the ascetics of the following orders : Those who worship the Fire God in forests or on river banks, those who worship (the omnipotent) Sun God, Elephant-faced Ganesa and His benevolent mother Parvati, those who recite the hymns of Gayatri (which are very sacred), those who ate vowed to bathe in the sacred Ganges everyday and those who maintain (absolute) celebacy. qaaranvengfraaat: aaa & feaat ara: crafaat vat aracttaares Fealaa: + faara ag ataarien fazer: eratferer freaet- atat araaat wa: Tat: azarsearfeverfar: uggn 31. The religious order belonging to the Moon attracts the following various persons : Those disciples who smear ## Page 209 Chapter 20 205 their bodies with sacred ashes, those who worship the Feet of Lord Siva, those who are abandoned by the society, those who are devoted to Bhagavati, those who give up company of others; those who take to Soma Siddhanta and those who carry bowls in their hands (for begging alms). sree AgaarTs | TAT: frat feat ovstfieraea 1 garaet zaarer— ferafexar: sy: waat ferfar: saitfara: aan 32. The Buddhist monks, the tonsured, those who wear white apparels, those who beg wearing good robes, those who wear blood-red clothes and those that have conquered their ‘five senses-all these mendicants are ruled by Mars. anifaat geferi anarfitet q dfareagqua: ag aes a1 wa agefafearradtes gan- eaat | Targeaisferefarfreaa: n3gu 33. Mercury denotes an alm-seeker, a conjurer, a snake Poison curer, and one who eats the flesh of a peacock. Notes: The words “‘qqzfafaaraa” are split thus: Wyt=peacock, fafira =flesh, staa= eat. Though it means that the native will live on the flesh of peacocks, it sounds peculiar to us. Some commentators have, however, inter- preted this as : one wearing the crest of a peacock, which meaning we are unable to detect.” om steerer aga gral avery SaraTeaet araseaqatat: saraensa 8 feta: 1 mgeta g dfean faafaa: agqagrad vat- eaai wed: qtxafaaedtag & caraar: van 34, The ascetics ruled by Jupiter are : those who hold a ## Page 210 206 Saravali single sceptre (or mace), those who hold three sceptres, those who wear-red coloured apparels, those who are in the. third stage of their religious life (arama), those who pull on: their lives with fruits and water (alone), those who still are attached to family ties, those who maintain celebacy and those who take to visiting shrines etc. argrraadteraag 8 fata dgaat: 1 aoaraacorerats at Rar vata: TR NAN 35. Venus rules the mendicants of Saivite and Vaishna- vite sects. qevsaafacat ferret fretat Fa) Aorafeafacitan: sramaregirrra ZeaTA: UREN 36. Religious hypocrites, bare mendicants and the ascetics who sit under shadowy trees in forests are ruled by Saturn. sefargiratt coat afe ear- aguactane ager Taq! waafa feat afrtarget serra: | eae TATHAGATA URI 37. Should Rajayogas be simultaneously present along with the above ascetic yogas, all the evil results are nullified and the native will become very virtuous, will be adored by all the kings, himself becoming aking and will take to reli- gious order. efa aeargadfaefaarat arerreat saearat art Faaiseara: "Rett Thus ends the 20th Chapter, entitled ‘Combinations for Renunciation’ in Kalyana Varma’s Saravali. ## Page 211 Chapter 21 207 BY ARATMETT 12

uanrefaeaca: Sfaar aeg araaT ATFAT “meren saghuaraat arfaafeg eet ne 1. NABHASA YOGAS: Yavanas have explained 1800 kinds of Nabhasa yogas out of which I detail below 32. Notes: The effects of these yogas are supposed to be experienced by the native, irrespective of the Dasa periods. Balabhadra in his illustrious ‘Hora Ratna” adopted this *sloka of Kalyanavarma, so to say 32 are major Nabhasa yogas. that are generally dealt with. aeqaaeanias HienacerAAtaat: | auratagaar aigancaga awit zu arat agideg aabert aarfagrga: 1 graweyazeny wy: There at ae MA: AN Bara HAA AMAA: TMA Tea: | avrrarary uigatfuear qaawegaaayny tl Yu 2-4. KINDS OF NABHASA YOGA : The following are the 32 Nabhasa yogas Nau (qt) Chatra, Koota, Chaapa, Sringataka, Vajra, Damani, Pasa, Veena, Kamala, Musala, Vapi, Hala, Sara (#1), Samudra, Chakra, Maala. Sarpa, Ardha Chandra, Yava, Kedara, Gada, Pakshi Yupa, Yuga, Sakata, Soola, Danda, Rajju, Sakthi, Nala and Gola. The Asraya Yogas, viz. Musala, Rajju and Nala are dealt with by Acharya Manitha. Notes: The 32 Nabhasa Yogas consist of 20 Akriti yogas, 7 Sankhya yogas, 3 Asraya yogas and 2 Dala (Ardha) yogas. Veena yoga is called Vallaki yoga by some exponents. ‘As per Varaha Mihira, Asraya yogas are dealt with by Sathya vide sloka 2, ch. 12 of Bhrihat Jataka). Magyar aAukarTAATANT A: | waa dearem: gatard: agiger: uy u ## Page 212 208 Saravali 2 wedaadt yaAATA Tuetatat avefasrat fanfare: efaatea arfaa: ug 5-6. Gola, Yuga, Soola, Pasa, Veena (Vallaki), Kedara and Damani are the seven Sankhya yogas. The two Dala yogas viz. Sarpa (Bhujanga) and Mala are explained by Parasara Maharshi. Savitracharya death with remaining 20 yogas. Note : Sce Parasara’s statement : wrarer: af wart zaatt watferat | maa sat afahad aterarragagaat: | warafairanaferanat: eat AAT: We Ut 7. One born with an Asraya will obtain the good effects, viz. happiness, advantages and qualities, provided there is no other kind of (Nabhasa) yoga present in the horoscope. If other (Nabhasa) yoga is present in addition to an Asraya Yoga then the effects of Asraya yoga do not ccmeto pass, but the other (Nabhasa) yoga prevails. Notes: As we have seen, the three Asraya yogas are Musala, Rajju and Nala. Should one of them be present ex- clusively, without the presence of another kind of Sankhya, Akriti, or Dala yoga, then only Astaya yoga comes to pass. Alternatlvely if an Asraya yoga is present while one of San- Khya, Akriti or Dala yogas is present, then Asraya yoga fails and the other yoga prevails. See sloka 5 in Nabhasa yoga chapter of Hora Ratna. arate eadatad qesaaar aatrar: eatat: | sau deagerarafaattg 8 aa us tt qeanaasaalear: aarata sitfaa Aart) dead sara gear adat fawat ue aafag cand: safatata vafaeacigeatad tea at aafaeqd g:andia we TAMA gaat AAA gol 8-10. EFFECT OF AKRITI, SANKHYA AND DALA YOGAS: One born in Akriti yoga will be satisfied with his own fortunes, will carn through a king, be dear to king and be famous. Should there be a Sahkhya yoga, the native will ## Page 213 Chapter 21 209 be happy only with others’ wealth, will live only through others’ help will and be always not peaceful. A native with Dala yoga will sometimes enjoy his own fortune, yet sometimes that of others, will pick up the fruits thrown on the ground by others, be sometimes happy and sometimes sorrowful. Notes: Out of the Nabhasa yogas, Akriti yogas are superior followed by Sankhya yogas i.e. the former gives best results while Sankhya yogas gives mixed-both bad and good- effects. The last kind of Nabhasa yoga, ie. Ardha (Dala) is an inferior yoga and such a native is solely dependant on others. Srifenczdea: aed: HAT At: ey: at-me-ega-areien faa: qaaatg: 0 ge Ul I, NAUKA, KOOTA, CHATRA AND CHAPA YOGAS: If the seven planets occupy continuous houses starting from the ascendant and the other three angles, yogas called Nauka, Koota, Chatra and Chapa are respectively formed. Notes: 1. Nau or Nauka yoga is formed when the seven planets occupy the seven continuous houses from Lagna i. e. from ascendant to the 7th house. See an example chart: Logna | ae Mel Veous Jupiter NAUKAYOGA Mcon Saturn In this kind of yogas, the presence of nodes is not taken into account. With the help of the above chart, the other 3 yogas explained in the present sloka can be grasped as under ; ## Page 214 210 Saravali ” 2. Koota yoga is formed when the seven planets occupy the Séven continuous houses from the 4th house, i. e. fromthe 4th through the 10th. ‘ 3. Chatra yoga is formed when the seven planets occupy the seven continuous houses from the 7th house, i. e. fromthe 7th through the ascendant. 4. Chapa yoga forms when the seven planets occupy the seven continuous houses from the 10th house, i.e. from the 10th through the 4th.» This is also called Karmuka yoga. warfamtraragy graferaigdin: = go-av-afea-aogt: . qearavifiar freq vez 12. YUPA, SARA’ SAKTHI AND DANDA YOGAS : If the seven planets occupy four continuous houses counted from the ascendant and its angles, the resultant yogas are known as Yupa, Sara (or Ishu-arrow), Sakthi and Danda respectively, Notes : In the previous sloka, the 4 yogas are formed by planets in seven continuous houses from Lagna and its three angles, while the present sloka deals with 4 kinds of different yogas formed by seven planets continuously in 4 houses from Lagna and its angles. Yupa yoga is formed if 4 houses are continuously occupied by the seven planets, counted from the ascendant, i.e. in the Lagna, 2nd, 3rd and 4th houses. See an example chart as under : Legna ms \Jupiter Mars [Moon Venus| Saturn YUPA YOGA ## Page 215 Chapter 21 21 The seven planets should only be in the said order. The grouping can be in any number within the requirement of the stipulation. 2. Sara (Ishu) yoga is formed if the seven planets restriet themselves within the 4 houses continuously, commencing from the 4th house, i. e. in the 4th, Sth, 6th and 7th houses. 3. Sakthi yoga forms if the seven planets are posited in continuous four houses, commencing from the 7th through the 10th house. 4. Danda yoga is constituted if the 4 houses from the 10th to ascendant are occupied by the seven planets. The formation of Sara, Sakthi and Danda yogas can be conceived from the example chart given for Yupa Yoga above, There should not be any vacant house in between, in these 4 yogas as well as the ones under the previous sloka. acaatagea: «Feng etait exseararadaaeaitat ArT Ra 13. ARDHA CHANDRA AND GADA YOGAS : If the seven planets occupy cotinuously seven houses commencing from a house which is not angular to the ascendant, the yoga produced is known as Ardha Chandra (Ardha Sasi) yoga. Gada yoga forms when all the seven planets occupy two succesive angles from the ascendant. Notes : Ardhachandra yoga should not commence from the ascendant, 4th, 7th or 10th from ascendant. It can start from the 2nd, 3rd, Sth, 6th, 8th, 9th, 11th or 12th and the planets should bd stationed continuously in seven houses. For example, if this yoga starts from the 2nd house, all the participating planets should be in the 2nd, 3rd, 4th, 5th, 6th, 7th and 8th in continuous order. Gada yoga is formed by all the seven planets remaining (a) in the ascendant and 4th, or (b) in the 4th and 7th or (c) in the 7th and 10th (d) or in the 10th and ascendant. Thus, there are 8 kinds of Ardha Sasi yogas and 4 kinds of Gada yogas. ## Page 216 212 Saravali ataeana: ated: 114: gaadatdafa aay | fardddadt fad: qa afesfeadatat nex u 14 VAJRA, YAVA, PADMA AND VAPI YOGAS: If benefics occupy the Lagna and 7th while malefics are in the 4th and 10th Vajra yoga is formed. Conversely, if malefics are in the Lagna and 7th while 4th and 10th are occupied by benefics, Yava yoga is preduced. If all the planets are disposed in four kendras, Padma (Kamala) yoga is formed. Should the seven planets be relegated either to Apoklima houses (3, 6, 9 and 12th) or to Panapharas (2, 5,8 and 11 houses), Vapi yoga is formed. Notes : There is a technical flaw in Vajra yoga. Malefics ie. the Sun etc. should be in the 4th and 10th while benefics like Mercury and Venus should be in the Lagna and 7th. There cannot be so much elongation between the Sun and Mercury or Sun and Venus that they are 4 houses apart. This defect lies in Yava yoga also. That is why Varaha Mihira too raises a query in sloka 6, ch. 12 in BrihatJataka as to how Mercury and Venus can be inthe 4th house from the Sun. He simply explained Vajra, Yava and the like according to ancient sasthras. Gunakara in Hora Makaranda also states in this context : qqfeaga? waa faaat aa waafifa asfeey | areand: wed agdanariradatzan: 1 samen ean ga fea TySH AHA ATU ey UN 15, SAKATA, VIHAGA, HALA AND SRINGATAKA YOGAS: If all planets occupy only the ascendant and the 7th house, Sakata yoga is formed. Similar participation of all the planets in the 4th and 10th houses constitutes Vihaga (Pakshi) Yoga. Should all the planets be in mutual trines, avoiding the ascendant, Hala yoga is formed. All planets relegated only to the ascendant and its trines give rise to Stingataka yoga. This Sakata yoga, a kind of Nabhasa yoga, is different from the usual Sakata yoga, popularly formed by the mutual quincunx position or 2/12 position of Jupiter-Moon, seg ## Page 217 Chapter 21 213 Phala Deepika, ch. 6, sloka 14. The present yoga is simple and needs no explanation. Vihaga (Pakshi) yoga forms whenall planets are in 4th and 10th only. Mercury, Venus and the Sun should fall either in the 4th or in the 10th in lot and they cannot be separated in this yoga. Hala yoga is formed if all the planets are in mutual trines, but not falling in Lagna. This naturally restricts the participation of Sth and 9th houses as well. Thus, the seven planets sohuld be in groups as under : (a) 2nd house and its trines, i.e. 6th and 10th, or (b) 3rd, 7th and 11th-mutual trines, or (c) 4th, 8th and 12th-mutual trines Thus, there can be 3 kinds of Hala Yogas, which make the planets remain in mutual trines. Srinagtaka means a triangle. When all the planets are in mutual trines a triangle is formed. In this casc, the planets should be in ascendant, Sth and 9th. In Hala Yoga and Sringataka, the seven planets get distributed to 3 different Rasis while in Sakata and Pakshi yogas, the participant houses are 2. The trinal yogas (Hala and Sringataka) are better than the other two, Sakata and Pakshi, formed by opposition. craara etait aguaanadaeany | malaaa =o tasamrnrat | wasaafa: neg 16. CHAKRA AND SAMUDRA YOGAS: Should all the planets occupy alternative Rasis commencing from the Lagna, Chakra yoga is formed. If these occupy alternative Rasis from the 2nd onwards, Samudra yoga is formed. Notes : In Chakra yoga all the planets (excluding nodes) should be in six odd houses commencing from Lagna. These should be in six even bhavas commencing from the 2nd, to cause Samudra yoga. The following charts will give an illustration of these two rare but exemplary yogas : ## Page 218 214 Saravali Lagoa Sun Venus Mere Mars CHAKRA YOGA Moon Sat Mars | Lagna | Venus Sun Mere SAMUDRA YOGA Moon Sat Sup In both the yogas, each planet has an aspect from another planet. Chakra yoga does not involve any trika house and hence its results are more splendid. It particularly involves angles and a trine. Samudra yoga involves the 6th, 8th and 12th also. Then the good results will be far improved if these 3 houses are occupied only by such lords. For results, see slokas 35 and 36 infra wearefan oa faarfreert war agigegn: | araTTAT set AIA FEET N go It ## Page 219 Chapter 21 215 17. Thus, [ have explained the twenty different Akriti yogas. Now, [explain the Asraya yogas as per the schools of thought of senior Garga etc. saafearatded: addaqaatena: waT | aig odtraqdatar «oadsa aadtituesu 18. ASRAYA AND DALA YOGAS : Should all the planets be in dual Rasis, Nala yoga is formed. Similarly, if these are in Fixed Rasis, Musala yoga takes place and in movable Rasis Rajju yoga is formed. All angles occupied exclusively by benefics cause Maala yoga while malefics in all angles produce Sarpa yoga. These two are Dala yogas. Notes : The seven planets disposed in all dual Rasis, i. . Gemini, Virgo, Sagittarius and Pisces produce Nala yoga. The four Fixed Rasis, i.e. Taurus, Leo, Scorpio and Aquarius should contain all the seven planets so that Musala yoga is formed. Movable Rasis i.e. Aries, Cancer, Libra and Capricorn shall be occupied by the seven planets to produce Rajju Yoga. In these 3 yogas, all the four respective Rasis, in cach case should be occupied and none should be vacant. The rising degree has no consideration here. See the example charts given below : Mars Saturn Micon | NALA YOGA! ir Sun Jup Mere Venus ## Page 220 216 Saravali Moon Mars Saturn MUSALA YOGA | Sun Venus | Mere Jup Moon Mars Sun Ven RAJJU YOGA! Mer Saturo Jup In the case of Mala yoga, the benefics should occupy four kendras. That is all the four kendras should be occupied. 100% natural benefics are only Venus and Jupiter. Mercury is not a benefic if he is with a malefic, and the Moon with losing rays is a malefic. This is as per standard astrological principles. Malefic participation is prohibited in this yoga and hence Mercury should remain a benefic. The Moon is a benefic from the 11th day of Sukla Paksha through Sth day of Krishna Paksha, as she is normally described in the various texts. There can be a 76° ciongation between Venus and Mercury and hence they can separately fall in angular signs mutually. Now, keeping these details in mind, see the following chart ## Page 221 Chapter 21 217 in which Maala yoga (also called as Srak yoga by Varsha Mihira) is depicted : Moon (oa Jup | (Sat) 5 IMAALA YOGA | | Lagna Veous (Sus) | Merc. Note the pos of the Moon with reference to the Sun and at the same time ina Lagna Kendra. Also note the malefics not falling in any angles. They can be anywhere other than the angles. Sarpa yoga is formed when the 4 angles are occupied by malefics. We have only three natural malefics, i. e. Saturn, Mars and the Sun. The 4th one is made up by the Moon as explained under Maala yoga. Mercury cannot be Separately in angle as he cannot become a malefic without the company of a malefic, provided he is with Rahu or Ketu. To make Mercury a malefic, is not possible here as the Sun and Mercury cannot be mutually angular. See the chart as under : Moon ac | | SARPA YOGA Logna M: Saturn oe ## Page 222 218 Saravali-. In’ the said yoga, if Mercury, Venus or Jupiter be angular, then Sarpa yoga stands nullified. ueaaatfaded: deareat: equate aT: t Magayadat: Fare: rmaradtedta: nee 19. SANKHYA YOGAS: If all the seven planets occupy one Rasi, Gola yoga is formed. Similarly in 2 Rasis-Yuga yoga, in 3 Rasis-Sula yoga, in 4 Rasis-Kedara Yoga, in 5 Rasis-Pasa yoga, in6 Rasis-Damani and in7 Rasis-Veena (Vallaki) yoga. Note : These yogas are simple and need no explanation. wast seat wait gamed gfafireaaq | adameatt saa: AHA UA gafearAt: Ut RoW afacitasitafaaar agin: earamtaat geet: | Bret afsat gear ataeqarsaar: Geet: u ye th * 20-21. EFEECTS OF NABHASA YOGAS ; NAU YOGA : The.native’s livelihood will be through water ; he will have many gains, will be very famous, be pleased, mean, strong and stingy. ‘This and others yogas are effective at all times indepe- ndant of Dasas. Notes : According to Brihat Parasara Hora Sasthra (ch. 35, loka 36), the native with this yoga, will derive his liveli- hood, through water and become wealthy, will have many desires, be famous, wicked, miserly and dirty. (The name a} suggests a boat and hence isa favourable yoga for business abroad, through water, navigators, divers etc.) Varaha Mihira in Brihat Jataka states that happiness in not uninterru- pted with this yoga (vide ch, 12). The reason is that a boat is not destined to remain steady in one place and moves to and fro in many conditions. Jataka Parijata explains away this yoga, stating “dbaaedta sft” meaning that one with Nau yoga lives through water. Jatakabharana says thus: One with Nau yoga will be famous, be a miser, be devoid of happiness (asagainst Varaha’s “interrupted happiness”), be always miserable, fickle-minded and will live by stolen wealth. Parasara’s ¢qrat in the sloka ## Page 223 Chapter 21 219 concerned reads in Kalyana Varma’s statement as 7@4! both differently meaning ‘very greedy” and “many gains” respectively. However, Balabhadra’s statement in his Hora Ratna is identical with that of Parasara. Kalyana Varma. Apparently means that the native will have many gains in professions related to water. In this yoga, two watery signs will always be involved and hence livelihood through water is obviously indicated. arafoefinraaraacran ffteoaat: Get: HT: Reagan fred wafa fafegiarfaet agen: 0 32 0 22. KOOTA YOGA : The native with Koota yoga will be a liar, be crafty, be a jailor, be poor, wicked, cruel and will always live in hills and fortresses. Notes : Parasara in his Hora Sastra (ch. 35) attributes similar results while Varaha Mihira (BJ, ch. XII) denotes a liar and a jailor with this yoga. The native will carry out cruel acts according to Jataka: Parijatha, (ch. 7). Vide Jatakabharna, the native will be devoid of wealth, will do blameworthy jobs, be devoid of knowledge of the right and wrong and will be fraudulent. Similar veiws are found in Manasagari. PAMATAA TATA STAT TTATAM: THAR: | sraasra aafe at: gaaaga: fraraqana: 230 23. CHATRA YOGA : The native with Chatra Yoga will help his own men, be kind, liberal, dear to king, very iatelli- gent, and will enjoy happiness in boyhood and at the end. Notes : Similar results can be seen in Brihat Parasara Hora Sasthra. Varaha Mihira, however, states that the native will be happy (only) at the end of his life. (BJ, ch. 12). Hora Makaranda denotes that the native will have a small body with this yoga. According to Manasagari, the person will be a scholar, be endowed with all kinds of happiness at the beginning and at the end, and will be blessed with regal paraphernalia. Hora Ratna, ch. 6, adds “long life” to the effects. ## Page 224 420 Saravali The native will be very rich and strong in the words of Jataka Parijata. To sum up, three important angles being occupied in this yoga, the subject will be long-lived, rich, strong, happy and will enjoy all royal comforts in the start and at the end. The 4th, Sth and 2nd unoccupied, if coming under adverse aspects, may lead to financial downfall, obviously in the middle of life. As the opposite houses will be occupied, the Sth, 4th and 2nd will receive some aspect. arafrngitaqransater: feararea ara fata: | ered omar wnafagiar | aataeh nex 24, CHAPA YOGA (KARMUKA YOGA): The native with Chapa yoga will be a liar, jailor, thief and will live in forests, He will not have wealth in the middle of his life. Notes : The results attributed for this yoga (otherwise called Karmuka yoga) in Brihat Parasara Hora Sastra (ch 35) are : the native will be a liar, will protect secrets, be.a thief, be fond of wandering in forests, be devoid of luck but be happy in the middle of his life (QaTtat7a), Brihat Jataka (ch. 12, sloka 16) asserts that the native will be brave and will be happy in the beginning and end of his life (wasn af Hora Ratna’s sloka, though verbatim taken from Parasara, has a change at the end, reading Waétat Taha only to fall in line with Varaha Mihira. Jataka Parijatha gives the effects tersely thus: fond of wandering in forests, bea theifand be blameworthy. The native will be highly honoured and will be able to use arrows ete. (i.e. weapons). The short and the longof the effects: the person with this yoga may turn out to be a dacoit, robber etc. using guns and such other weapons. Should malefics like Rahu, Saturn etc. be strong, this yoga will in all probability produce a person as above. gam: faa: seater qafear afea: | afarangecgar vata alsdaeare®t uy 0 ## Page 225 Chapter 21 221 25. ARDHA CHANDRA YOGA : One born with Ardha Chandra yoga will be fortunate, be an army chief, be brilliant bodied, dear to king and strong. He will possess gems, gold and ornaments. Notes: Vide Brihat Parasara Hora Sastra, one with this yoga will be an army chief, will possess a splendorous body, be dear to king, be strong and be endowed with gems, gold and ornaments. According to Brihat Jataka, the person will be fortunate (gyn), beautiful, be chief, dear to king and will enjoy pleasures. ‘The native will earn fame through the king, be excellent a person, and will possess golden ornaments, as per Jataka- bharanam. This yoga will be superior if it starts from 2nd, Sth, 9th or 11th and the effects will be full. Should it start from 3rd, 6th, 8th or 12th, it will only be medium. The first kind may give plenty of wealth, fame etc. while the latter cannot give so much of these. aiaraaata afaar: get: gaat fadatera t avafagiar ast ara: camfaegrd nag 26. VAJRA YOGA: One born with Vajra yoga will be happy at the beginning and end of his life, bold, beautiful, free from sickness. unfortunate, and be inimical to his own people. Notes : qx is interpreted here as beautiful, though it also means fortunate as the author has used arqfagtar in the same breath, to denote misfortune. While almost a similar view is denoted in Brihat Parasara Hora Sastra in respect of the effects of this yoga, Brihat Jataka states that the native will be happy in the initial and concluding portions of life, be beautiful and valorous. Vide Jatakabhrana, the native will lack happiness in the middle of his life. He will be given to anger and be libidinous. wafanagaget amet aed qarddgen: | arent: feacfaet a atrvat: aar gear: un 21, YAVA YOGA : One born with Yava yoga wil observe ## Page 226 222 Saravali fasts ‘and other religious rules, be intent on doing auspicious acts, be happy in the middle of life, be liberal and will have lasting wealth. Notes : One with Yava yoga will maintain fasting etc, be interested in doing auspicious acts, will be endowed with happiness, wealth and children in the middle of his life, be liberal, and be firm in disposition (vide Brihat Parasara Hora Sastra). This yoga is good for fame, enthusiasm, peace etc. as per Jatakabharana. But Vaidyanatha departs from these statements and asserts that the native will be happy in the end of his life, see Jataka Parijata, ch. 7, sloka 176. wala qureat: aera fagaaeaa: Heat: | gare: ofadtar: saewvar aan freq got 28. KAMALA YOGA : One born with Kamala yoga wi be highly famous, very virtuous, assuredly longliving, very rich, very bright in appearance, and will be the lord of the earth. Notes : Parasara’s version is also almost similar, vide Brihat Parasara Hora Sastra, ch. 35, sloka 30 while Brihat Jataka tersely states that the native will be widely famous and will enjoy limitless happiness and virtues (ch. 12, sloka 14). According to Hora Makaranda, the native will be a king and be rich, see qaferefeft, fafaerd fagufea: fracrigadgar: gear 1 aaagqaarigeer arial | aT Stat: Re 29. VAPI YOGA: One born with Vapi yoga will be skil- ful in amassing wealth, will enjoy lasting riches and happine’s, be beautiful and will be endowed with happiness from sons. Notes : Brihat Parasara Hora Sastra adds that the native will have comforts of eyes (74494) (free from eye defects), and will be a king. Varaha Mihira declares that the native will have some but lasting happiness, will hide money underground etc, but not be charitable. Gunakara sees a miser “in this yoga. ## Page 227 Chapter 21 223 Vide Jataka Parijatha, the native will hide money under- ground. As per Jatakabharanam, the native will be a scholar, be intelligent, valorous, long-living, be an ornament to the faimily, be endowed with all kinds of happiness, and will speak sweetly. — "Since the 8th house is involved in this yoga, perhaps the scholars expect that the person will have a tendency of keeping secret his monetary possessions. He may not be out-spoken in such matters. al teat: gaat gat: aHergsitfaed facear: 1 eanafaagian wm? oat waft ATU zon 30. SAKATA YOGA : One born with Sakata yoga will be troubled by diseases, will have a bad wife, will be a dunce, will live by pulling carts, will be poor and be without relatives and friends. Notes : Same results are found in Brihat Parasara Hora, with an addition that the native will have bad nails. Brihat Jataka (ch. 12, sloka 13) denotes that the native will have a bad wife. (As the 7th and Lagna are the only houscs for the planets to occupy, this yoga may throw heavy weight on the married life.) Since driving of vehicles is indicated, this may make one an ordinary driver of bullock cart, hackney, bus etc. if the chart is inherently weak. Should the natus be strong, the native may be a pilot of an air-plane, well paid railway driver etc. warereaay faneet aat: qzargenfaat qe: | sagfrarea fred fagt att war mat: ag 31. VIHAGA YOGA (PAKSHI YOGA) : “The native with this yoga will be intent on wandering, will have mean habits, will be a messenger, will live through sexual dealings, shameless and fond of quarrels. «Notes : Though {° means bold, it has been translated as shameless here to befit the context, This word also means be rude, insolent, presumptuous etc. According to Jatakabharana, the native will be deviod of happiness and pleasures, will wander fruitlessly, will always ## Page 228 224 Saravali live in distant places, and will speak much inspite of his having nothing. Baad RATT asa: TETRA | qAHAHTEA TET T TAT aMat | Wararg w aR 32. GADA YOGA : One born with this yoga, will always care for honour and money, will perform yagnasete., will be expert in sastras and music, and will be endowed with money, gold, jewels and wealth. Notes : This isa favourable yoga for Mantras and such other achievements. The native will always devote his time to spin money by various means: In this yoga, all the planets from the Sun to Saturn should be disposed only in two angles from Lagna. framagantargagfaat 7a: frat: gaTHTAT: | aie yafageat: yew wal AGT: Wag 33. SRINGATAKA YOGA : One born with this yoga will be fond of quarrels, be a warrior, be happy, dear to king, will have a fortunate wife, be rich and will hate the fair sex. Notes. By virtue of all the 7 planets resorting to the ascendant and its trines, this yoga forms a Grand Trine of the planets. Thus the other six planets will be blessed with the company or aspect of Jupiter. The ascendant and two trines will also be so. Hence this yoga will be greatly influenced by Jupiter and can reach the native to enviable heights. Saturn in the Sth or Lagna can cause some simultaneous blemish to marriage. watfad afta: autant g:faarea ae: 1 wyggerara: «sear gaat | get: nay 34. HALA YOGA : This native of this yoga will eat in plenty, will be indigent, will have agricultural profession, will be subjected to grief, be emotional, be forsaken by relatives and friends, and will be a servant. Notes : Though this yoga also requires the 7 planets to be mutually in trines, inasmuch as the ascendant is prohibited, ## Page 229 Chapter 21 225 the two trines will also be not in the picture. Hence this is not a superior yoga as against the Sringataka yoga. Thus opposite results will occur. smataaactfarintecarareghare: | wafa atat agueas at aaa at au 35. CHAKRA YOGA: One born inthis yoga will be a king at whose feet will be the heads of the other prostrating kings adoring diamond-studded crowns. (That is, the sub- ordinate kings, wearing diamond-studded crowns will honour a Chakra yoga native who will be the chief of such kings.) Notes : This is a very superior Raja’ yoga for the reasons explained in the notes under sloka 16 of this chapter. Kalyana Varma explains this in a single phrase as in the words of sage Parasara while Varaha Mihira simply denotes an emperor. Jatakabharana states that this combination will make one good-looking, very valorous and rule over the entire earth. aguacet: fafaar atarigar safrararfa safeagear: gear: feacfaen: araaraza nag 36. SAMUDRA YOGA : Should a person be born under this yoga, he will have abundant wealth and precious stones, will be a king, be endowed with pleasures. be dear to people, will have steady mind and be truthful in disposition (“Satwavanta”). Notes : This yoga is only next to Chakra yoga, in giving good effects. ‘Three evil houses are involved in Samu- dra yoga and grade of effects will depend greatly on the occu- pants of 6th, 8th and 12th. The effects attributed by Jatakabharana ate: The person will be charitable, courageous, virtuous, kind, will derive king’s patronage and will make his family a fortunate one. The native’s family will attain a supreme state with this yoga. Note a planet should be in the 2nd in aspect to another in the 8th. If Saturn is in the 12th while Jupiter is also in the 6th, the 2nd house will be influenced by both Saturn and Jupiter. ## Page 230 226 Saravali Thus 4 planets helping the 2nd house can make one have a happy family. anafa wenfacaeaga fadteaaera: | aafranecafedt ga oat fafizra n zon 37. YUPA YOGA : The native with this yoga will have self-protection, be charitable, be endowed with riches and happiness, and will observe religious fastings and vows. He will be a distinguished person, Notes : Should this yoga be present in nativity, he will have spiritual knowledge, be interested in Sacrificail rites, be endowed with a wife, be strong, be interested in religious ob- servations and be distinguished. This is how Brihat Parasara Hora sastra describes Yupa yoga. Parasara uses the phrase suctfaz which has also been followed by Gunakara in his Hora Makaranda, see Gaararafaggeit. But Varaha Mibira uses MATT (vide BJ, ch. 12, sloka 15) which denotes “self- possessing” while Kalyana Varma entirely uses a different phrase : ATeHfTZET, Most texts have cither verbatim taken Parasara’s slokas with some face-lift or give the short and the long of his slokas, while particularly dealing with Nabhasa yogas etc. as for example the present chapter. Hence, it seems arenfag (to have spiritual knowledge) isa better account of the phrase concerned. qgRMaEMarqnaaTaanaaeAtat: | faa: gfaethreat: aeatlt aeNgaT: ea: 3c 38. SARA YOGA : The native with {<a17 will manufacture arrows (arms etc. in'modern context), will catch hold of thieves (for example, be a police officer), willlivein forests to hunt animals, will be equal toa mad person, will torture, and be fond of mean handiworks. Notes ; Vide Brihat Parasara Hora Sastra, one with this yoga will make arrows, will head a jail, will gather money through animals, will eat meat, will indulge in torture and in mean handiworks. Thus this combination can indicate jailors, arm dealers, people working in arm factories, hunters, butchers, hangers etc, ## Page 231 Chapter 21 227 According io Manasagari, one will be miserable, will derive pleasures in forests, will have a wife equal to Rambha, (a celestial dame) but will be never happy. Jatakabkarana also adds that such a native will not have any happiness right from birth. Hence, it may be understood that this yoga will not contribute to native’s happiness. aavigatanag facdtarcrateage: Geet: | aEmMag agar: weeat wrat: feret: FATT: URE 39. SAKTI YOGA : One born with this yoga will be devoid of wealth, deformed, subjected to grief, mean, lazy, short-lived, expert in war and be beautiful. : Notes: Similar results are discussed in Brihat Parasara Hora sasthra also. gagqaarehaear: aasateagar: arate: | gfaacter: gear wsswaT At: aaATTN vo Nt 40. DANDA YOGA : The native with this yoga will lose his wife and sons, will be poor, discorded by all people, be out of the men of his circle, be grieved, mean and will be servant. Note : One born with this yoga will lead the life of servitude and be bereft of those dear to him (BJ, ch. 12) while according to Gunakara, the author of Hora Makaranda, he will be a servant, be fond of pleasures of the world (safe fit) and will be very miserly. The world 34f@ also means progress or advancement and the person will make efforts to go forward in life as the houses involved in yoga are such: viz 10th (karma of profession), Ith (gains), and Lagna. However, he cannot make much advancement. He will be deviod of wisdom, vide Jatakabharana. On the whole this combination is not favourable for wife and children and will lead only to servitude rather than making one a head. fed ganar aigaqenrehitrarrat: | wre: gagedter Ararat AMAA: eT ve ## Page 232 228 Saravali 41. MAALA YOGA : One born with arat att will always be happy, be endowed with conveyances, robes, wealth and pleasures, splendorous and will have plurality of wives. Notes : This falls under 74 4 (Dala yoga) and HTaT Att is formed when all the four angles are occupied by benefics, excluded by malefics. This is a very rare yoga. The present sloka is also verbatim taken by Kalyana Varma from Parasara. The only difference is 4 in our text which is found as s+ in Brihat Parasara Hora Sastra, The practical approach remains the same in the whole context. Varaha Mihira denotes that such a native will enjoy all pleasures. Vaidyanatha follows the suit. The native will be endowed with friends, sons, beautiful ornaments, clothes, conveyances etc. He will be attached to the fair sex for enjoyment (vide Jatakabharanam). This yoga gives happiness and pleasures according to Hora Makaraada, « faaar: a fa:ear fed g-arfaar: qalarea | qzaanuenfazar: ad mat wafa AM: U¥VN 42, SARPA YOGA: The native born under this yoga will be crooked in disposition, pitiless, always be a subject of gtief, poor and will live in other’s houses and eat their food. Notes: This is opposite to Maala yoga and is formed only by malefics in the four angles from the ascendant. This is the second Dala Yoga. The occupation of only malefics in all the 4 angles, according to Varaha Mihira is capable of causing abundant miseries to;the native. The nativewill be devoid of wealth and be sorrowful, vide Hora Makaranda. Vide Jataka- bharana, the native with Sarpa yoga will eat other’s food, be short-tempered, indigent, fond of sleeping, will have evil pride and will be akin to snake when he will have to help others, i.e. will be helpful to none. Should only malefics occupy the four angles the evil results attributed by the texts willcometo pass. The native cannot make money in life, will be unhelpful to others but depend on them and be very miserable, ## Page 233 Chapter 21 229 weafsat: qeq: qeahsataral agai: | HU: GReTATat TyNAT: sar fst: u xz 43. RAJJU YOGA ; The subject with this yoga will be fond of wandering, attractive in appearance, will earn money in foreiga countries, be cruel and mischievously disposed. Notes : Since all the planets are relegated to only mov- able Rasis, the native will always be on the move, i.e. will not live long in one place. He cannot make his livelihood in his native place but will eke out the same elsewhere. maeaaagar: eataaar aafsar: waar: | fearfaen gacitear waa qu: aat gear: Uy 44, MUSALA YOGA : One born under this yoga will be endowed with honour, wealth and wisdom,’ be attached to his duty, be liked by king, be famous, steady-minded and bold. Notes : Out of the 3 yogas, viz Rajju, Musala and Nala, the present one (Musala) is good Raja yoga compared to the other two. As the seven planets will only be in fixed signs, the native will have his livehood in place, will be permanently in one place (i. e.) be free from changes of and on), and will retain anything earned on a lasting basis. satfaftaatar aadacifnatsfafagares | agfgara gea aaa =o area yy.n 45. NALA YOGA : One born with aq att will have uneven physique (i.e. some limbs long and some short), will gather money, be skilful, be helpful to his relatives, and be attra- ctive in appearance. Notes : In this yoga, all the four dual signs are involved and hence the native will have mixture of previous two yogas. Such natives may often marty more than once. If the Lagna is also a fixed sign, two marriages are sure to follow. atftauraeagat faardaraafaar afaar: | fred gfaadtar ate ati wafa atu ¥en 46. GOLA YOGA: One born in this yoga will be indi- gent, indolent, devoid of learnig and honour, dirty, and always grieved. ## Page 234 230 Saravali qrassarinat ar aacigat at afgogar a gaaraaizigat qnatt aIaat | ATAT: xe 41. YUGA YOGA : One born with this yoga will bea religious hypocrite, be bereft of wealth, forsaken by people, and devoid of sons, honour and virtues. aterraaaacigar gar: gafgenat FEAT: | aearmmateat: Ye tat: NSTAFA MW ¥5 SULA YOGA; The native with Yq 477 will be harsh, indolent, poor, torturous, become a prohibited person, bold, successful in war and fearful. Note : The word @q has been translated as “rash” to befit the context, though it also means : sharp, hot, passionate, intelligent, strict, hard etc. gagargqatenr: gutaen: weratfer: gferat: | Bart argaaaeaatat | AAARAT: 1. ve 49. KEDARA YOGA : One born under this yoga will be useful to many, will have agricultural profession, be truthfully disposed, fickleminded and wealthy. TR ATA: Higa: TISATITITT | agurfcat faster agaeat: AFAYAT: HA: 1 YoU 50. PASA YOGA : One born with T1417 will be bonded, be attached to work, worldly in disposition, will talk too much, will not have good qualities and will have many servants. arfteargaartt ryrmagad) aagadl qe: | aggaretagal ite ferry sora: | eaTG UR 51. DAMINI YOGA : One born with this yoga will be helpfull, will have cattle, be lord of money, be foolish, will have many sons and jewels, be bold and learned. fantfaat: qaqa: meaqet daarafaaee | gaat agyear aturat atfaar Aga: yz ou 52. VEENA YOGA: One born with this combination will have friends, be eloquent, interested in sastras, musicial instruments and singing. He willbe happy, will have many servants and be famous. i i aretacat areata anda faaiiserra UR gi Thus ends the 21st chapter, entitled “Nabhasa yogas” in Kalyana Varma’s Saravali. ## Page 235 Chapter 22 231 BA TIAMAT: WRU Chapter 22 Effects of the Sun aaa aaerd agufagqad wet aeATg wanieaa: soeatq finserarata aarfeeru gn 1. The effects of the planets and the zodiacal signs accrue to all and at all times. I now attempt to expiain these according to the teachings of the rest of the preceptors. areaaafarafa: ext qafra: savesa 1 sara samefae aferae: ft es: Ru aigamnifara: frarararfaerfaacaga: | qa vafa atx: cagererit ad oan gu 2:3, THE SUN IN ARIES : One who has the Sun in Aries will comment on the meanings of Sastras, be famous in arts, fond of war, fierce, attached to his duty, fond of roaming, will have strong bones, be good in deeds, will do valorous acts, will be subjected to bilious and bloody disorders, be splend- orous and strong. The native will also become a king. Notes: If the Sun is in Aries at birth the native will be able-to receive help from great men. He will be endowed with abundant wisdom. The exaltation of the Sun gives proneness to frequent wanderings. The word “Narendra” in the text, though translated as “king” keeping in view the tradition. it additionally means “cuter of poisons’’. The Sun in Aries may denote able doctors, poison-curing physicians etc. To lend boost to monetary aspect, the Sun in Aries be better assisted by friendly planets. This position is a good augury for political aspirations. Jaraka Jambunadeeyam adds that the Sun in Aries indentical with ascendant gives wealth. Coming to practical analytical aspect, the Sun in Aries is not the same for all the 12 ascendants. He, for that matter- any planet, gives different effects, though it be in the same Rasi, for the various ascendants. Hence, an account of the effects with reference to the 12 ascendants is necessary to be known. ## Page 236 232 Saravali With Aries rising, the Sun in Aries causes Raja yoga; the native achieves name and fame among the men of his race. Should Taurus rise with Sun in Aries, the native will be engaged in good deeds and spends heavily. For a Gemini nalive, the Sun in the 11th in Aries, makes him rich through brothers and bestows status in Sun’s dasa. If the Sun is in Aries for a Cancer birth, the subject will earn huge wealth and enjoy very high (political etc.) position. Should a Leo native have the Sun in Aries, he will enjoy conveyances, power, wealth etc. and will get good effects throughout Sun dasa. A Virgo native, who has the Sun in Aries, may not get good results in Sun’s dasa if he is conjunct with others than Mars or Saturn. He will however spend away his money on good account. Should the Sun bein the 7th in Aries fora Libra native, he will enjoy a superior Raja yoga through his wife, partnership etc. The wife may be from a very affluent race. Should a Scorpio native have the Sun in Aries, he will lose the whole of paternal property and face adverse -results in the Sun’s period and will experience debacles throughout life. He may also face loss of children. Should Sagittarius ascend at birth with the Sun in the Sth in Aries, the native will acquire great inheritance from father and will reach high position with conveyances. A Capricorn native with the Sun in Aries does not enjoy mnch of maternal happiness but a greater longevity. He is also prone to heart diseases. One who takes birth in Aquarius while” the Sun occupies Aries, will acquire a worthy, chaste and forutnate wife while a native of Pisces (with the Sun in 2nd) cannot retain any money even if he would earn a. lot. He will be subjected to physical deficiencies and diseases. areal agyett ofa gafafaat agate: 1 garam qa waw frie wafeuvn aenlenedd: AT: | ATARARTATTT: | wage cae aril Asitaaitta: yn Seq: que Ara: araglaagga: wit ogadee® aeaat afetamara ng ## Page 237 Chapter 22 233 afeafaat arar aqaeat dearast arsft 1 awl qeyeee gweaa waa A et gfaauearmat agag: elearad dt: vtaqg faaet feast waa geet gacfegatg: srifeardt wafeqeafa: 1 aiwa faaaet cfaaaafadifind qe: nen 49. SUN IN A SIGN OF MARS IN ASPECT TO OTHERS : Should the Sun be in a sign of Mars (i. e. either in Aries or in Scorpio) and be aspected by the Moon, the native will be interested in giving away gifts, will have many servants, be charming, be dear to fair sex, and will have a soft physique. If the said Sun is aspected by Mars, he will display his courage in battle, be cruel, will possess eyes, bands and legs of blood- red colour, be splendorous and strong. If the planet aspecting is Mercury, the subject will be a servant, will do others’ jobs, will not bave much wealth, be devoid of strength, be subjected to much grief and will prossess a dirty body. Jupiter aspecting the said Sun denotes that the native will have pleaty of money, will donate, be a king's minister, a judge and a supreme person. If Venus aspects the Sun posited in a house of Mars, the native will be the husband of a bad women, will have many enemies but few relatives (or not well-placed relatives), be poor and will suffer from leprosy. In case Satura aspects the Sun in the said condition, the native will be subjected to grief on account of physical ailments, will have intense passion in his undertaking, be dull-witted and a dunce. Notes : According to Hora Ratna, the combinations mentioned in this chapter and those up to ch. 29 hereof are as per Satyacharya. Hence it seems to us, the word farseraraty in sloka I of this chapter may be a misprint that occurred possibly in th course of communication to us and the author Kalyana Varma might have used the word gorarafq im his original writing. Balabhadra was a later author, who adopted all these sloka verbatim in Hora Ratna acknowledging Saravali. And during his time (i. ¢. 1654 A.D.), he might have got the correct text. ## Page 238 234 Chapter 22 aearfertinaca: sterafgoy: Sa A azge: | wed) eqagreal afeary arearqargat i go tt Weraargerrag — AaareyeH: | feaaet qaaed wate gary afeeritere ue 10-11. SUN IN TAURUS; The position of the Sun in the sign Taurus indicates that the native will have troubles from disease of face and eyes, will endure difficulties, will have an emaciated body, will not have many sons, will be beautiful (aeq also means fortunate, nice, handsom ete. ), will possess decorum, be wise, will hate barten (or confined) women, be endowed with eatables, garlands, robes and scents, will have knowledge of singing, playing musical instruments and dancing and will face risk from water; Notes: An Aries naitve with the Sun in Taurus cannot make much money. He will also spend away his earnings. Should the Sun be in Taurus idnetical with “ascendant, the native will look very beautiful, be endowed with the quality of Satva and will suffer from urinary diseases. For a Gemini native, the Sun in Taurus will give troubles from enemies, litigations and loans and expenditure on vices and through evil association. Ifa Cancer birth has the Sun in the 11th in Taurus, the native will gain abundantly through wife and females and will experience good results in Sun’s dasa. Ifa Leo Lagna native has the Sun inthe 10th in Taurus, he will acquire rich conveyances and authoritative positions. The Sun in the 9th in Taurus for a Virgo birth is evil for children and can show a great miser. Should a Libra native have this planet in 8th in Taurus, he will frequently be in monetary troubles. One who has the Sun in 7th in Taurus (i.e. birth in Scorpio) will face obstacles in the celebration of marriage and will acquire a sickly wife. He will acquire gains through marriage. Ifthe Sun isin the 6th for a Sagittarius birth, the native will have problems of litigations and debts. A Capricorn native with Sun in Sth will be longlived but will experience . obstacles about children. The Sun in 4th for Aquarius births will give gains through marriage and high learning. Should a ## Page 239 Chapter 22 235 Pisces native have the Sun in the 3rd in Taurus, he will suffer from diseases of the ear, may lose co-born and will enter into litigations with brothers for paternal property. aerefagera «— aggafaaarsat wafa! ferarafaanaa qc afaar afsastat 920 qe aeamefaetaed atgaraeratia: | fara faawat gadget gama fare: 0 230 fafatermeagerntarfefaeracita fagaafa: | ferare faawat gadget waq gag: ey il aguafracet qvafaasaredtar: str: famare faanat gear ez geitfaat qafa: 11 ex 1 aafeqqnest ar eitanagatndga afta fear® faawat faadet waste un eit ateitsaat afed agectdnal facasta: 1 faaara faawat afsecd carfiaeaca go 12-17. SUN IN A SIGN OF VENUS IN ASPECT TO OTHERS : One who has the Sun in a Rasi of Venus aspected by the Moon will be addicted to prostitutes, will be soft- spoken, will have many women as dependents, and will derive livelihood through water. If the planet aspecting is Mars, the said Sun denotes that the subject will be brave, fond of battle, bright in appearance, will earn wealth and fame out of his valour, and will be deformed. Should it be Mercury that aspects the said Sun, one will be skilful in drawing, writing, poetry, authorship, singingetc. and will possess a good physique. If Jupiter should lend his aspect to the Sun in Libra or Taurus, the subject will have many foes and friends, be a king’s minister, will have beautiful eyes, be splendorous, and will be a pleased ruler. When the aspect is from Venus to the said Sun, one willbe a king or a king’s minister, be endowed with wife, wealth and pleasure galore, be wise and timid. Saturn aspecting the Sun in fall or in Taurus denotes that the native will be mean, indolent, will cohabit with aged women, will be wicked and will be troubled by diseases. ## Page 240 236 Saravali Rerdt avenge areaeaquda: aarare: | faarrrreagaa agit sarcagrea gsi fagut satfacten aeanedt fearqe: GAT: | fagaed farradfe ara: gaat fart: ear ugen 18-19. SUN IN GEMINI : One who has the Sun in Gemini will be a scholar, will be sweet in speech, affectionate (parti- cularly to one’s offspring), will have good conduct, will be expert in profane knowledge (derived from worldly experience which is opposite sa j.¢. knowledge of Brahman or Supreme Spirit), and also in Sastras, be exceedingly affluent, liberal, skilful, be an astrologer, be mediocre in appearance, will have two mothers, be fortunate and modest. Notes : If Gemini ascends along with the Sun, the native will suffer from lasting sickness and will have difficulties from enemies and debts. Should the Sun be in the 12th in Gemini for a Cancer birth, the person will be subjected to child mor- tality if the Sun’s dasa occursat birth. He cannot retain paternal property and will be spoiled by evil friendship, if malefics assist the Sun. In the case of a birth in Leo ascend- ant, the Sun in Gemini gives a fortunate father and excellent results in his Dasa. If Virgo ascends at birth with the Sun in the 10th in Gemini, the subject will visit shrines. A Libra native with the Sun in 9th in Gemini will obtain fortunes. One of Scorpio with this planet in 8th in Gemini will have short life. The Sun in 7th for a Sagittarius birth will bestow a chaste wife and good effects in his Dasa. Though there will be litigations fora Capricorn native with the Sun in 6th, ultimate success will be his. An Aquarian with the Sun in the Sth in Gemini will have only one issue—a son. One born in Pisces with the Sun in 4th will have limited effects regarding lands, education etc. Should Aries be the ascendant, the Sun in the 3rd in Gemini will make him valorous. A Taucus subject with the Sua in 2nd in Gemini will contract eye diseases and will have declining wealth. fegaruagatist fated! agfaarity ganaa faaaife et ae gem: cag URN ## Page 241 Chapter 22 237 feguawagatat cwurcaratfagfadt ata garrat faawdic gata wafa sats: ueen qaftratea: carat araaatgetstefiea aeraa: | geet faradfe guetsearraga: aT URI agueaafagal ust gat fataaravs: | gaerat ferndfc gear ge edt: nan arargaafgat owaeigeaaraa: afer: | gacait fanfic faadest 9 Hee Re gerailinanat agargfadtadt aan fea: 1 gazrat feavdic at farting firaa: un 20-25. SUN IN GEMINI IN ASPECT TO OTHERS: Should the Sun be in Gemini or Virgo be aspected by the Moon, the native will be put to troubles by enemies and relatives, will be distressed by visits to foreign countries, and will in general be wailing, The Sun in a house of Mercury and in aspect to Mars denotes that the subject will have fear from enemies, will be encountered by quarrels, will be grieved on account of loss in war, be poor, and bashful. Should Mercury aspect the Sun posited in Gemini or Virgo, the subject will have a history akin to that of a king. will be famous, be endowed with relatives, free from enemies but will encounter eye diseases. Jupiter aspecting the Sun in a sign of Mercury foretells that the native will have knowledge of many Sastras, be a king’s messenger (or representative), will go to foreign countries, be fierce and be always bewildered. If Venus aspects the Sun, posited as above, the native will be endowed with money, wife and sons, will make less friends, be free from sick- ness, be happy, and fickle minded. Should Saturn aspect the Sun in Gemini or Virgo, the native will have many servants, be anxious (as for an absent lover), willmaintain many relatives, will remain delighted and will be crafty. wie ata: earat gia arert eatefadet eiein: ger: wafrard: satire: ue 1. sfgetrar ## Page 242 238 Saravali nafia: aeat art avaraatafeaar qa getedea agfeafe: fraser non 26-27. SUN IN CANCER : The Sun in Cancer indicates that the native will not be steady in mind in respect of his undertakings, will be famous by virtue of his royal qualities, will hate his own men, be unfortunate in respect of wife (or have an ugly wife)!, will be good looking himself, be troubled due to imbalances of phlegm and bile, be distressed on account of labour (i.e. to hard work), will like intoxicants, follow virtuous principles, be honourable, will be eloquent, will be a geographer (27a) anda scientist in the matter of atmos- phere/space (feraut), will be very steady, and will hate people from paternal side. ‘Notes : One born in Cancer Lagna with the Sun therein will suffer physical ailments, be irascible and will be one-eyed. For Leo ascendant, the Sun in 12th will cause birth in ordinary circumstances; the father’s riches will increase gradually. If a Virgo birth has the Sun in 11th in Cancer, the native will indulge in bad acts and will expend in evil ways. One born in Libra while the Sun is in Cancer, will take sacred baths in the shrines from the Setu (of Ramayana) to Himalayas. A Scorpio subject with the Sun in 9th in Cancer will lose his father carly. If the Sun is in Cancer for a Sagittarius native, he will cut short the life of the native and that of the father. Should a Capricorn native have this planet in the 7th in Cancer, he will have a loving wife but she will suffer from bilious diseases. One born in Aquarius with the Sun in the 6th will also face similar results as by a Capricorn native. If a Pisces Lagna native has the Sun in the Sth, he will lack happiness from children while an Aries native with the Sun in Cancer will lack maternal happiness but will acquire fortunes in the Sun’s period. The planet in question if be in Cancer, a Taurus subject will have a brother who will be widely famous; though the native himself may enjoy good fortune in Sun’s dasa, it will not be long-lasting. Lastly, a Gemini native with the Sun in the 2nd will have heavy expenses and will contract many a isease, 1. Full Moon, however, gives a beautiful wife if the Sun is in Cancer, ## Page 243 Chapter 22 239 et waaat ar waagaafeafa: HT: 1 wae dle eet afar | ART Ea: RSH Mera: aerat agi: ag facet mpes faa tha fadifat fear Use faaramamtfa: eqrat araeat qa geteaait gaa we fare: pH AY Uat Aeat Bareratsa anfaaea aa oafrraree gear gt mereafien: uae eateat gafaer: carieet wt saver) maeney ga ga uted fata: naan wees: § Ieeaart faeitafaaee: | amenea wat cagaet gar firga: u33n 28-33. ASPECTS TO SUN IN CANCER : If the Sun in Cancer is aspected by the Moon, the person will be a king or equal to a king, will become rich by business through water, and be cruel. Should Mars throw his aspect on the Sun in Cancer, one will contract pulmonary consumption and fistula in the anus or pudendum, be dejected on account of his relatives and be aslanderer. If Mercury aspects the Sun in Cancer, the native will be famous for his learning and honour, be dear to the king, skilful and will destroy enemies. Should Jupiter throw his aspect in Cancer occupied by the Sun, the native will be pre-eminent, a king, a minister, or an army chief, be very famous and learned in arts If Venus aspects the Sun in Cancer, the native will subordinate his wife (or women), will have money through his wife, be helpful to others, fierce in battle, and will speak sweetly. Saturn’s aspect on the Sun in Cancer denotes that the person will suffer from phlegmatic and windy disorders, be wicked and be a tale-bearer. fegerat ateraet faapacet aarfaatac: 1 seaét | avaxedoredt aiaweramt tte: naw weit: feazecdt gaz: farfarraat areqa: t faget fares? ara: gaat WaTaTA: REN ## Page 244 240 Saravali 34.35, SUN IN LEO: If the Sun occupies Leo, the native will destroy his enemies, be given to anger, will perform notable acts, will wander in forests, hills and fortresses, be enthusiastic, valorous, bright in appearance, will eat meat, flesh etc; and will be formidable. He will be restive, strong in a last- ing measure, talkative, be a king, be plentiful in wealth and be famous. Notes : If the Sun is in Leo for a Leo birth, the native will marry twice; or he may seek extra-marital pleasures. He will be beautiful and famous. A Virgo native with the Sun in Leo will spend on evil company. For births in Libra, the Sun in 11th in own house will confer fortunes and full span of life. In the case of Scorpio, the Sun inthe 10th in Leo will give conveyances, power, position and Raja yoga. For those born in Sagittarius, the Sun in the 9th in Leo will harm the co-born and give fortunes to the surviving co-born, He gives a long span of life to the subject. One born in Capricorn with the Sun in Leo affects longevity if unhelped by Saturn, An Aquarian with the Sun in Leo will gain a chaste and fortunate wife. If born in Pisces, the Sun in Leo, will give sickness both to the native and his wife. An Aries native with the Sun in Sth in Leo will confer royal honours and only one male child, who, howe- ver, will reach high strata in life. For Taurus Lagna, the Sun in 4th in Leo, will give good employmental career while in the 3rd for Gemini ascendant, it gives only one brother who will be very famous. A Cancer native with the Sun in 2nd in Leo will get abundant riches, a lion’s share of which will, however, drain away. Reardt gaaa: warfedt qracaat WAH: | aft fat aq frttfaa wafe uaen TRAIT: YT aTgTHT Fataet te) feaamt fag’ goa et paTATT RON fagra fafaerac: fearareat ofewafa gta: 1 faget® fern? gda ed a agaea: nec ## Page 245 Chapter 22 241 Rarerractara Beifa aearfrat faorrattar: | fag oo agercat «— gequest Marga: uRen qatagesttieirga fagat fama) faa fafaefaart «gaa fade ora: von rafaarrraar: weet Aa: | TAITATTNT: | fagex feast eaqaet gary waft een 36-41. ASPECTS TO THE SUNIN LEO: If the Sun occupying Leo is aspected by the Moon, the native will be a scholar, will have a good wife, will suffer from phlegmatic disorders, and will be dear to king. Should it be Mars that aspects the Sun in Leo, the native will be interested in others” wives, be courageous, valorous, revolutionary, formidable and chief. If Mercury aspzcts the Sun ia Leo, the person will be a scholar, a writer (or an exponent), a gambler, be wandering- matured, mean, and be endowed with great strength. If the Sun in Leo is aspected by Jupiter, the person will construct temples, gardens and tanks; will have predominant strength, will like loneliness and be highly intelligent. Venus aspecting the Sun in Leo will make one earn bad name (infamous). Such a person will be troubled by leprosy, be unkind, and shameless. Should Saturn aspect the Sun in Leo, the person will be skilful in creating obstacles, will be a eunuch, and will cause grief to others. wageaggiam fatter gars aegaa: | Fert aga faery PATH: ATEUTT we aarerfemiqg oo za: afertaarercfegee: 1 ware feqaet sia | aedlraraaes ean 42-43, SUN IN VIRGO : Should the Sun be in Virgo at birth, the person will possess a physique akin to that of a female, be a scholar, be weak, be an expert writer, be learned and will render service to Gods and elders. He will be expert in repairs of driven vehicles, will be skilful in Vedas, songs and playing instruments and will speak softly and kindly. ## Page 246 242 ‘Saravali Notes: The Sun in Virgo ascendant is not conducive to longevity and will cause heavy expenses, Fora Libra subject, the Sun in Virgo in the 12th can cause child mortality or drain- ing away father’s earnings, One born in Scorpio with the Sun in Virgo will earn and save abundantly, particularly in Sun’s dasa. A Sagittarius native with the Sun in Virgo will enjoy great Raja yoga and fame. For a Capricorn native, the Sun in Virgo will not give paternal happiness. If he be so faran Aquarius subject, the native will acquire a sickly wife. For those born in Pisces, the Sun in Virgo may deny marriage and the father’s character may be questionable. If an Aries native has the Sun in Virgo, he will have loss of children and may him- self suffer brain diseases. The Sua in Virgo for a Taurus native is a good position for learning and landed property. A Gemini native with the Sun in Virgo will face obstacles in education and will lack maternal comforts. For a Cancer birth, the Sun in 3rd in Virgo gives one living brother. Should Leo ascend at birth with the Sun in Virgo, the native will be longlived; will have a big scar on the abdomen and will have agricultural gains. aRaaaat fataamifearet es araagat fatgcoattarfaroasttat queen goa: qemdta: aeareefa: gat waerfea: 1 ai garavedaaofewa: | sare eu 44-45, SUN IN LIBRA : If the Sun is in Libra at birth, the native will face frustration, destruction and heavy expenditure, will be intent on living in foreign places (out of distress), be wicked, mean, be devoid of affection, will live by selling gold and other metals, be jealous, fond of doing others’ jobs, will co-habit with others’ wives, be dirty, will incur royal contempt and be shameless. Notes ; six is translated here as “shameless” though it has others good meanings like, illustrious, eminent, energetic, skilful etc. The Sun in Libra 10 degrees is singly capable of nullifying all other good combinations in the horoscope. ## Page 247 Chapter 22 243 The Sun in Libra will give the following results for the various Lagnas. Acies : There will be loss of children, heavy adversities and destruction of paternal wealth-all in Sun’s dasa. The native may not havea long-living wife while his married life will be a hell on the earth. Taurus : The native will face loss of landed property, will incur heavy debts and contract long-lasting diseases. Gemini : The person will be bereaved on account of brother’s death and will have an equilibrium of loss and gain. Cancer: The native will lose children and money, will prove evil to father and will cause loss to paternal property. Leo : The native will ever suffer from physical ailments and will be not outspoken. It will be difficult to measure his depth. irgo : He will earn money in iflegal manners and will at last have nothing. Libra : The Sun in fall in the rising sign is capa- ble of making life unenjoyable. The person will be a source of iseries galore. Scorpio: The subject will have a defective limb and will face a checkered career. Sagittarius : The native will lose his father in boyhood and will always be engaged in legal battles. Capricorn : He will be unlucky and short- lived, Aquarius: He will lose his wife and suffer pecuniary losses. He will not have good relationship with father and co- born. Pisces: He will be short-lived and will throughout face many difficul On the whole, the Sun’s placement in Libra is not good for anything in one’s life, unless the planet has some redeeming features at birth. afrarfcacaan: afaracigat a aerate: | sfargeggafa: 9-H: geifriara ween Manisaget ctfag: sagarenitsqaary 1 aeafafar: figsrara git: wt won 46-47. SUN IN SCORPIO : The native with the Sun in Scorpio will have an incombatible lust for war, be away from Vedic (or religious) path, be a liar, a dunce, will have a base and wicked wife (aqyafr also means loss of wife), be cruel and be attached to mean women. He will be irascible, will ## Page 248 244 Saravali follow bad course, be a miser, be fond of promoting quarrels, be troubled by weapons, fire and poison, and be unfortunate in respect of parents. Notes : The Sun in Scorpio will give different results for the different ascendants as under > Aries : Physical adversities, loss of children and loss of finance. Taurus : the native will acquire a beautiful and active wife but may encounter health hazards for the wife in Sun’s dasa. Gemini : The native will be troubled by enemies and his own co-born may be inimical to him. Cancer: The native will have to face loss of issues. Money will be scarce. Leo : The person will earn abundant landed property, learning and fame, Virgo: He will not gain much in Sun’s dasa, but will incur heavy expenses on his father’s health, Libra: The native will have splendid earnings only to lose. Scorpio : The subject will enjoy great fortunes in life. Sagittarius: The native will spend on religious and charitable deeds. Capricorn : This ascendant gets along-span of life and great fortunes for the native. Aquarius : The native will attain high position after marriage. He will become a very famous individual. Pisces : the native will have an affluent father, and will enjoy along lease of life. He will be engaged in exposition of religious scriptures and will attain fame. wearfadt qtert ara: ara: atfeorgea: | aearenafertrarfagat Baga ase west qa: wat cael aaa faedtoritrareag: | aaat fret oo aeage: ads aA vent 48-49, SUN IN SAGITTARIUS : If the Sun at birth is in Sagittarius, one will be endowed with wealth, be dear to king, learned, will respect Gods and brahmins, be skilful in rendering training in use of weapons and arrows and breeding of elephants, be fit to deal with, be honourable, be always peaceful, be rich, will possess a broad and beautiful physique, be helpful to relatives, and be energetic, ## Page 249 Chapter 22 245 Notes: The Sua in Sagittarius gives varied effects for the 12 ascendants as under: Aries : The native will earn abundant wealth and be honoured with important governmen- tal assignments. He will acquire issues who will be fortunate and highly educated. Taurus: He will face evils on account of Mantras and will contract many physical ailments. Gemini : This is an inauspicious position for one’s wife. Cancer: The subject may end in huge loans. Leo : The person will be highly fortunate and will have limited issues. Virgo : He will not have a healthy mother and will be a source of bad name to parents. Libra: He will be highly fortunate and will live in foreign countries. One of the co-borns will take away all paternal wealth. Scorpio : He will attain an enviable position in life, and enjoy along span of life. Sagittarius : He will enjoy great Raja yoga and be very famous. Capricorn : He will be subjected to child mortality, If long-lived, he cannot make much prosperity. Aquarius: He will have abundant riches and landed property. He will enjoy a supreme married life. Pisces : He will have limited wealth but boundless fame. avafafanaga: anfadt qraet faraaite: 1 aracfaerat age get RAT TTT: yo ems wea: eReaaal faciteraera: | qi avacficradt atta frdfert | aoe: een agree fafa: areqnaralfesarrarga: | gey afaafe et gaa saad waft nuan faacfa atearwal qoftat arcaeaaagaa: 1 ager faaeafa qeat et aar faery wan feeqeatitrga: amanrearfafa: afer: aera wat gee frtfaa ara: ween aafa: cereet « atargearraguaasits: 1 aang qd nea fattfee wafer neen ## Page 250 246 Saravait 50-55. SUN IN SAGITTARIUS|PISCES AND ASPE- CTED BY OTHERS : Should the Sun at birth be in a Rasi of Jupiter and be aspected by the Moon, the native will be endowed with (eloquent) speech, wisdom, wealth and sons. He will be equal to a king and be devoid of misery. He will also’ possess a pleasing body. Should Mars lend aspect to the Sun in a Rasi of Jupiter, the subject will earn fame through battle, be endowed with clarity of speech, money and happiness, and be short-tempered. Mercury aspecting the said Sun denotes that the native will possess sweet speech, and will have knowledge of writing, literature, arts, assembly, journey and minerals. If Jupiter aspects the Sun in Pisces/Sagittarius, the person will move in royal palaces or be a king himself, will possess elephants, horses and wealth, and be ever after learning. Should Venus aspect the Sun in Jupiter’s house, one will enjoy women of superior class, be endowed with scents and garlands and be peaceful. If Saturn aspects the Sun in Pisces or Sagi- ttarius, the native will be unclean, will eat others’ food, will join bad men and will breed animals. ya: gelaw: geddafaa: agra: agelacat wWefadiaageacafa: wag azafratseraca: cara faettrarhraren: | wey ferant oat aguas: Gea: nwo 56-57, SUNIN CAPRICORN: One who has the Sun in Capricorn will be base, interested in bad women, be greedy, will advance with mean jobs, be endowed with various deeds, be timid, devoid of relatives, fickle-minded, fond of wandering, weak, will lose everything due to conflicts with his relatives, and will be a voracious eater. Notes; The Sun in the sign Capricorn bestows different effects for the 12 signs at birth as under : Acies : The Sun gives superior Raja yoga and fame, Taurus: The native will gain through enemies and cousins and will be happy. Gemini: The native will experience many miseries. ## Page 251 Chapter 22 247 Cancer : The native will enjoy yoga but experience diseases to some extent. His wife will contract vaginal diseases. Leo : The native will be of sickly constitution and be inimical to all. Virgo : He will have only one male issue who will be famous. The subject will experience good effects in Sun’s dasa. Libra: The native will achieve high degree of learning and pursue excellent profession. He will, however, be not happy with his mother. Scorpio: The native will have ordi- nary results in Sun’s dasa, He will have many enemies in his undertakings. Sagittarius : There will be no balance of money left with the native. Capricorn: The native’s longevity will be curtailed. He will suffer some sickness or the other throu- ghout. He will bea synonym of misfortune if Mars is in fall simultaneously. Well-posited Venus is an‘ essential require- ment for a Capricorn native with the Sun in Lagna, Aquarius : The position of the Sua in Capricorn will make the native’s wife have secret relations with others. She will be inimical to the native at all times. Pisces : The native will attain success over enemies, be free from diseases and will be bereaved due to his child’s death. ararageacrata: ARAMA gTET: | wage dieet aia frteae = waft nec aarfafacfzfades: reeagrg weafaetatae: 1 weaqa fafrcfedt waa fadtfea faea: nen qe wesglt: reset = aarcaaty afertafaa afk gaa data sala gon aaarat afta adararaat fagaetia: 1 wreaqa feandf geur gt aaedt a ugen agsaraafufedttafa «= asargaraasga: 1 waaaa fearat gga ei adh ara: ew tdaafa agri | Tteaeafearata: 1 wrt areye aires? qa aisett eau ## Page 252 248 Saravali 58-63. SUN IN CAPRICORN|AQUARIUS ASPECTED BY OTHERS : If the Moon aspects the Sun in a Rasi of Saturn, the native will be highly cunning in disposition, and will lose his wealth and happiness on account of his befriending females. Mars aspecting the Sun in Capricorn or Aquarius denotes that the native will be troubled by diseases and enemies, will be wounded by weapons on account of quarrelling with others, and be deformed. If Mercury aspects the Sun in Capricorn or Aquarius, the person will be brave, will have a eunuch’s nature, will steal other’s wealth, and will have all limbs devoid of strength. Should Jupiter be the aspecting planet, one will undertake to do auspicious deeds, be wise, will patronize all, widely famous, and intelligent. If Venus aspects the Sun in a Rasi of Saturn, the native will deal with conch, coral and ruby, will derive abundant wealth through prostitutes and females and be happy. If Saturn aspects the Sun posited in Capricorn or Aquarius, the person will destroy his enemies and will prosper due to royal honours. gant oagaea: wat faaguisfrctaer) qari at: anifeafa fafaat wate evn Zasiscwa: weraftadtest afsaryfa: 1 graatse ota: fga: cag soreraTa nen 64-65. SUN IN AQUARIUS : If the Sun is in Aquarius at birth, one will suffer from heart diseases, will have enormous strength (courage), be very short-tempered, be fortunate through other housewives, be hated by the learned, be firm in his activities, be miserable will have little wealth, be fraudulent, be not firm in friendship, will have dirty body and be a miser. Notes : For the 12 ascendants, the Sun in Aquarius is capable of conferring effects as under : Aries: The native will attain excellent professional growth and wide fame. Taurus: He will become a dealer of gold, or become a prominent jurist, be in the king’s employ and be happy with his mother. Gemini: He will be inimically ## Page 253 Chapter 22 249 disposed to his father and will sometimes be lucky and some- times unlucky. Cancer : He will be short-lived and if Sun's dasa operates, it will be fatal. He will not inherit any property from his father. Leo: He will have strained relationship with his wife and the spouse will have many health hazards. Virgo: The native will acquire property through enemies or will gain from them. He will be subjected to diseases. Libra : He will have a famous elder brother. Scorpio: He will have afieet of conveyances but be not free from danger through conveyances. His end will be through violent animals or unnatural means. Sagittarius : He will have a short-lived father. Capricorn : He will himself be shortlived and will have robbery and such other professions as livelihood. Aquarius: He will live in his inlaws’ house if Saturn is simultaneously in Leo. Pisces : He will be troubled by diseases and debts. He may lose his eye-sight if Venus is also in Aquarius. qeat dugaite: otter aeadteaeare: 1 stat agyart: gated) wafa oaatat nga eeqagaragal TTT: | TavTearel sisagerenat «= agagst — ataaeAsw gon 66-67. SUN IN PISCES: If the Sun is in Pisces at birth, one will be friendly, will have tendency to amass, be fond of women and happy, be learned, will destroy many enemies and be wealthy and rich. He will be endowed wife, good sons and servants, will have wealth on account of tran- sactions via sea/river, be an cloquent speaker but a liar, will suffer from diseases of the private parts and will have many a co-born. Notes: Posited in Pisces, the Sun gives the undermen- tioned different results for 12 different ascending signs. Aries : The native will undertake to perform meritorious acts. He will not enjoy paternal wealth. Progeny will be delayed but later on he will acquire many children. Taurus : He will have huge financial gains and will enjoy wide fame. He will be ## Page 254 250 Saravali quite learned. Gemini: He will lead a very honourable life and will undertake to visit religious places. Cancer: He will will not enjoy paternal happiness. There is also a likelihood of death of co-born. Leo: He will suffer from diabetes, bladder and various kInds of urinary diseases. The native will have | swollen testicles. Virgo: He will suffer from many diseases. Only one child is possible with this position. Libra : The native will face many obstacles in his undertakings, and will suffer from bilious diseases. Scorpio : Though Sun's dasa will give extraordinary results, loss of children will be experie- need, Sagittarius: He will enjoy a long lease of life, rich conveyances, political power etc. Capricorn: The native of this ascendant also will enjoy a fairlongevity. But death will be through fire, water etc. Aquarius: The native will be subjected to various diseases. If Jupiter aspects the Sun, dropsy will result. Pisces: The native will become famous but be prone to sickness. Should the Moon join the Sun in Pisces, utter poverty will result. afer searqadfaciaarai arciacarnfeeaarcefeatn art aifamiseaa: ngz Thus ends the 22nd chapter entitled “Effects of the Sun in Various Rasis” in Kalyana Varma’s Saravali. BAY AFATEAIT URI

Chapter 23 Effects of the Moon in Various Rasis atauty: feacea: agafaciga: atedt are: SMa: AAT: FAagwaraSaM AAT: | sani: ofuardfaaganat ag arRreaa: wagner ufagakr: alfaat Aa wat ue ## Page 255 Chapter 23 251 1. THE MOON IN ARIES: Should the Moon bein Aries, the native will have a golden coloured body, will be endowed with lasting wealth, be devoid of co-born, be valorous, self-respected, auspicious, prosperous, libidinous, will have weak legs, ugly nails and little hair, be fickle-minded, will consider honour as wealth, will possess hands and legs like the lotus, (i.e. these will be lotus-red), will have more sons, round eyes, be friendly, be afraid of getting into watery places (like river, well etc.), will have wounds on the head and be won over by females. Notes : Should the Moon be in Aries at birth, the limbs of the body will be red as Mars is red like blood. If she is telated to Mars, the native can have famous brothers. There will be wounds on the body/head as Mars indicates wounds. The native will be prone to accidents from water, like drown- ing. He will seek sexual pleasures from many women. If the Moon is in Aries identical with ascendant she causes Raja yoga. (According to Jambunadeeyam, ch. 1, rule 46, the Moon though weak is good in Aries/Cancer identical with ascendant. She gives wealth, virtues, quadrupeds etc.) If it is weak Moon, the person will not be outspoken and will earn wealth through bad means. If it is full Moon, the person acquires physical strength, beauty and good qualities. This is. a very good position for lasting wealth. Should the Moon be in the 2nd house indentical with Aries, i.e. the ascendant being Pisecs, the native will enjoy Raja Yoga, par excellance, as she is the Sth lord. The native will have more daughters if it is full Moon and will lose children if it is weak Moon. If Aquarius rises at birth while increasing Moon is in Aries, the native will have many younger sisters. Even if it is decreasing Moon, her dasa will give good effects but loss of co-born. If Capri- corn be the ascendant with the increasing Moon in the 4th, the native will enjoy abundant lands, learning, conveyances, mater- nal happiness etc. If the Moon is weak, these will be ina lesser degree and the native will keep his wife’s mother to be maintained in his house. Should Sagittarius rise, while the Full Moon is in the Sth, the native will aquire one son (as she is the lord of the 8th) who will become very famous and if it ## Page 256 252 Saravali is decreasing Moon, the native will beget issues with great difficulty, For Scorpio ascendant, the Full Moon in the Sth is capable of removing debts, diseases, enemies etc. and if weak, then, these are quite limited, instead of being nil. If Libra rise at birth with Full Moon inthe 7th, the native will enjoy paternal bliss, paternal wealth etc. acquire a beautiful wife, but be occasionally subjected to physical distress. If it be weak Moon, the native will not be happy from the view- point of marriage. Even though the Moon may be Full and be in Aries for a Virgo native, it causes infant mortality if Moon's dasa occurs at birth; if it be weak Moon, it may with- out {fail cause death in its dasa coinciding with childhood. Should Leo rise at birth with Full Moon in Aries in the 9th, the native will be very fortunate and will enjoy paternal wealth, and his co-born will be greatly benefited; if it is weak Moon, the native will seek union with females equal to mother. If Cancer ascends with Fnll Moon in the 10th in Aries, the native will lead over monetary transactions and will enjoy rich posi- tion, conveyances etc. and with a weak Moon, the person will lose his parents early. For a Gemin native, the Full Moon in the 11th will supply money uninterruptedly and will give more daughters; if she be weak, the native will not financially Prosper. if one born in Taurus has Full Moon in the 12th in Aries, he will spend away all his wealth on charitable acts, and will be free from diseases etc. ifit be weak Moon, he will contract various kinds of venereal diseases and will be immoral. aeguadt atta: smart ated wotfa ara: 1 ae: aye car at aff AF wrarferetrraca: fafeearenfaeraarate: | aresfae: eared geet afafe gerd: wan arifaerara: — agtaa: earratsatg: | guest Aaey fraret aenfafagaaitfa: wen agqaaragat 9 qid: afaaraacicatstt Raye feaeett ees gaa gary Ta: it ## Page 257 Chapter 23 253 BM: qaraget aeqafafayatsert a ae fafireage oo agenafadtiad = wafer ngn fafegt agget | aftruagacitaatsqaarg | Ra fafteaga oo cfaaaafadtfird waft non 2-1. THE MOON IN ARIES IN ASPECT TO OTHERS : If the Moon is in Aries at birth, and be in aspect to the Sun, the native will he quite irascible, be honoured by the king, be soft, be valorous, and fond of war. Ifthe Moon in Aries is aspected by Mars, the person will suffer from diseases of eyes and teeth, will have wounds caused by arrows (or horse/cow etc.) and will suffer windy diseases’ and urinary disorders. Should Mercury aspect the Moon in Aries, the native will teach various disciplines, will possess good speech, will achieve his desires, be a great poet and be widely famous. If Jupiter aspects the Moon in Aries, the person will be endowed with servants and abundant riches, and be a king or a king’s minister Venus aspecting the Moon in Aries denotes that the subject will be lucky, be endowed with sons and wealtb, will own (i.e. marry) a supreme lady and costly o:naments and will not eat much. The Moon in Aries aspected by Saturn indicates that the native will be jealous, miserable to a great extent, be very poor, dirty and untruthful. Notes: The effects of the aspects of other planets on the Moon in Aries (or in any other Rasi) will depend on the rulership of the aspecting planet. For example, if Taurus rises with Moon in the 12th and is aspected by Saturn, the native will not be poor but instead he will be rich. Conver- sely if Jupiter aspects the said Moon for a Taurus ascendant, the native will not be very rich, but only rich in the ordinary sense. These results thus differ according to the lordship of aspecting planet concerned. aqeleenisfazrar sagfeawra: arya: atferateit ara: Wo GIaMaaat gacitaware: | Reard aeranit ggaiarrereararerg: arg: Trateags wigs gaafa: enfaget vateat uct ## Page 258 254 Saravali 8. THE MOON IN TAURUS : If the Moon be in Taurus at birth, the native will be large-hearted, highly charitable, short-haired, libidinous, famous, brilliant, will have (more) daughters, will possess eyes resembling that of a bull, be in a position to differentiate between good and bad, be happy dur- ing middle and concluding parts of his life, will have strong waist, feet, shoulders, face etc., will have (some) identity on the side and back of the body, will walk beautifully and be endowed with forbearance. Notes : This is the exaltation Rasi for the Moon and hence she will normally give good results. If she is Full and in good bhavas, benefic effects are sure to follow. If she is decreasing, then the results are proportionately less. See the following to know as to how she will act remaining in Taurus for various ascendants : If Full Moon is in Taurus ascendant, it she ws birth in affluent and noble family. This will make the native a famous personage. On the contrary if she is with diminishing ra ys and is in Taurus ascendant, the native will suffer from rheumatic diseases, cough, TB etc, and will have curtailed longevity. If she is Full and in the 2nd house identical with Taurus, i.e. for Aries ascendant, the native will enjoy Raja Yoga in Moon’s dasa and will have abundant wealth but be subjected to sick- ness ; if it is weak Moon, monetary gains are limited and diseases will be more. For Pisces ascendant, the Moon, if Full, in Taurus, will give famous children, wealth etc. If she is weak in the 3rd, a Pisces native will be subjected to throat disorders and will suffer lack of progeny. If an Aqua- rian has the Full Moon in Taurus, he will have fame but will have pressure of debts and diseases and cannot enjoy much wealth; if it is weak Moon, there will be no maternal happiness at all while learnings property etc. will be quite meagre. For a Capricorn native, the Moon in Taurus, if Full, will confer early and happy marriage; if she is weak, the native will have strained marital relationship and will seek pleasures out of marital bonds. In the case of birth in Sagittarius, the Moon in Taurus, if Full, will give medium longevity but will give ## Page 259 Chapter 23 255 some pressure on the front of diseases, debts etc. and if be weak, the longevity is quite curtailed and adverse effects will bein full. For Scorpio ascendant, the Full Moon in the 7th will give a beautiful and chaste wife, property from women and also political fame and wisdom ; if she be weak, marriage is almost in a pipedream and if at all it takes place, it will not prove happy. If Rahu/Ketu/Saturn give company to weak Moon in the 7th for a Scorpio native, the wife may develop illicit relatinoship with other men and may even elope from the house. If Libra be the ascendant with Full Moon in the 8th, the native will enjoy fair longevity, good position (with some downfall), but will not retain his earnings; if it is week Moon, the native will face umpteen obstacles in his career and may be shortlived while money will be very scarce with him. Should Virgo rise at birth having full Moon in the 9th in Taurus, the native will add to his paternal property and have all his own desires fulfilled while weak Moon will sometime or other cause debacles in money matters. Fora Leo native, Full Moon in the 10th in Taurus will bestow good conduct, property, posi- tion etc. but cannot reach the native to heights unless well- aspected by Mars, while weak Moon will give ‘many hindran- ces in career and show heavy expenses. If Cancer be the ascen- dent with Full Moon in Taurus, the native is born in wealthy family, enjoys all paraphernalia and is never short of anything in life; if the Moon be weak, the native will have to struggle hard to come up in life. Lastly if Gemini ascend at birth, the Full Moon in the 12th in Taurus is less problamatic while a weak Moon is a headload. waanfandat fereaquasayareareay | satires sect gay | tfadtfetaserz: nen afeerd guegt gafasd aperclaawy were ala ATga BH Ta TG FTA ngouw sit araafafad syferiee? ameererary waft gaa eg: aait qasquaqig mq ue ## Page 260 256 ‘Saravali feargaaragé arerftgufercanfatrgerg afanafafaerd mf greg: wait Fea ug HATA || TANT TeASATEATATY | arfirrgritere facferat af aat gad ugagn aagmatget aad argetar a gadtargt aafarayatgd cfaaceg: watt | Fea een 9-14. THE MOON IN TAURUS IN ASPECT TO OTHERS: Should the Moon be in Taurus, and be in aspect to the Sun, the native will be a farmer, be very industrious, be very rich with servants and quadrupeds, and will lend money on usury. If Mars aspects the Moon in Taurus, the subject will be highly libidinous, will lose his wife and friends on account of another lady, will steal the heart of the fair sex, and will prove adverse for the mother. Should the said Moon be in aspect to Mercury, the native will be highly learned, will know the code of speech, be of pleasing disposition, be dear to everyone, and will uncomparably be of good qualities, If Jupiter aspects the Moon in Taurus, the native will have long- living wife and children and lasting wealth, be respectfully disposed to his parents, be virtuous and very famous. Should Venus aspect the Moon in Taurus, one will be endowed with ornaments, conveyances and houses, and will possess comforts ofsleeping and sitting (ie, will possess luxuries of bed and sitting paraphernalia), scents, robes, garlands ete Ifit is Saturn that aspects the Moon in Taurus, one will be devoid of wealth, be inauspicious for mother and wife and will be endowed with sons, friends and relatives. Notes : The Moon in Taurus (or Libra) is a favourable position for money lenders. If she is aspected by the Sun (or Jupiter) the nalive will have money-lending as profession. This is very favourable for career in banks, financial institu- tions etc. Mars aspecting her in Taurus, makes the person very sensuous and he is sure to be of questionable character. When Mercury aspects the Moon in Taurus, such ## Page 261 Chapter 23 257 natives will do well to pursue some independent profession trade etc. If Jupiter aspects the Moon in Taurus, one will have a well-settled family life. Venus aspecting the exalted Moon indicates that the native can command anybody and will earn respect from anyone. If Saturn aspects the Moon, according to our experience, the native will reasonably be tich. Ido not know why the author indicates poverty in thit context except for the baneful lordship (9th house) of Saturn. Saturn aspecting the Moon in Taurus, can however throw some financial ups and downs, depending on the rising degree. This aspect can give a long life to the native, but may affect mother’s longevity in general, qaia aeqat oertge( acta a fata ware? oagh fagfadtt 9 oaeit ped nex 15. AFFLICTION TO PARENTS : Should the Moon be in the first half of Taurus, the mother of the native is not long- lived. Similarly, the father is short-lived ifthe Moon occu- Pies the second half of Taurus. Notes: This rule should not be verbatim applied. If the Moon is in the first 15 degrees of Taurus and the 4th lord and Venus are simultaneously afllicted, then the mother’s longevity may be at stake. Similarly, the Moon in the 2nd half of Taurus, while the Sun/Saturn and the 9th lord are heavily blemished, longevity of the father may beat stake. Alternatively, if the Moon occupies the 8th house in the first second half of Taurus, mother/father are respectively affected. sate: qrafafarerereas grit ara necarfaargt fawaraacel gfzae: face: ara: atnagrafaaaaga: catia cargargt arfa activa aed afi fagat aragrangy: neen 16. THE MOON IN GEMINI : If the Moon is in Gemini at birth, one will have prominent nose and dark eyes, will be skilful in the art of love, poetry etc., will enjoy sexual pleasures, ## Page 262 258 Saravali will have lines of fish in the palm, will be fond of worldly enjoyments, will be sinewy, be very intelligent, splendorous, be endowed with happiness, jocular disposition and elqouent speech, be won over by females, will have a long body, will be- friend neuters and will have two mothers. Notes: The Moon in Gemini ascending, at birth, gives the qualities of Mercury to the native in general. He will have a prominent nose, which mskes him look beautiful. As Mercury is a eunuch, the native will make friendship with neuters. He will enjoy sexual pleasures with barren females. He will be attached more to worldly pleasures rather than the Supreme Spirit, People born under this sign may be gifted speakers and if the Sun occupies the 10th, political aspirations can be noted to one’s advantage. The Moon remaining in Gemini acts differently for different ascendants as under : Aries ascendant: The Moon in Gemini gives expendi- ture galore and the native’s mother may face separation from his father. If the Moon is with diminishing rays, this is more certain Taurus ascendant: With the Moon in the 2nd in Gemini the native will have significant savings and will live long if she is Full. If she is decreasing, the co-born will suffer from mental diseases and lack of intelligence. The native will be rough in speech. Cancer ascendant : The Moon in the 12th if full will keep the native free from diseases and if waning causes diseases from childhood till the end. Such waning Moon will be an impediment in the overall growth of the native. Leo ascendant: With Full Moon, the native will acquire wealth through fair means and with waning Moon, the native will have frequent losses and will lack ability to satisfy his female in coition Virgo ascendant : The Full Moon in Gemini is capable of conferring high position and good income in the fields of publication, communication, radio/television etc. The native can amass wealth in Moon’s dasa. If she be waning, the native will resort to illegal profession, will have mean conduct, be subjected te vices and will lead a miserable life, Libra ascendant : If Full Moon is in Gemini, the person will undertake to visit Ganges, shrines etc. and will acquire ## Page 263 Chapter 23 259 paternal wealth. If it is declining Moon, there will be fre- quent misunderstandings with father, cousins etc. Scorpio ascendant : Even the Full Moon In Gemini cannot make any satisfactory contribution to longevity, not to speak of declining Moon. If the full Moon is helped by Jupiter/Saturn, then a fair longevity can be expected. Weak Moon in the 8thin Gemini is an insurmountable menace to tke prosperity of the native. Sagittarius ascendant: The Moon in Gemini will give a cunning and belligerent wife, though beautiful. Marriage is consummated with great difficulty. If she is weak and is particularly with the Sun, then the spouse lives only for a short period. Capricorn ascendant: The Moon in Gemini, if full, can reduce the scope of diseases to be -suffered by the wife while declining Moon almost gives a perennially sick wife. Gemini Moon for this ascendant will cause diseases of private parts both forthe male and his female. Aquarius ascendant : The Moon in Gemini does not promote the descent of the race and the native will not be able to fulfil his aims at any period of his life. If she is full, some redemption can be expected. Pisces ascendant : Progeny is delayed while birth of a male issue is doubted unless Jupiter is strong. The eldest issue will be doubtlessly a female. The results so far stated will depend on the state of the planet Mercury also. sared sari faga eafad guia t aiagfaanend = atta qa fara: neon afageatastat Gaagafaraeraeray t gw fat at ana fatiferdtsary ugcn ateraagad gw grit gat a1 cfaaraftcarst = frqh | gueitferrrarm: gen famararad = faend aeraranfaenq) ara arfmrafirg: wctfr geitfardt frat ion aega fa arearaeaat-ag aaa TAH: asi ged geal ages afaft fae ngen ## Page 264 260 Saravali grea araaled gafagafayfeatad arity wot ociteged fing af farareara: nen 17-22. THE MOON IN GEMINI IN ASPECT TO OTHERS : If the Moon is in Gemini at birth and is aspected by the Sun, the native will be quite learned, be splendorous, very beautiful, be charitable, be very miserable and be not rich. If Mars lends aspect to the Moon in Gemini, the person will be very valorous, very learned, be endowed with happiness, conveyances, wealth and beauty. This is certain. The Moon in Gemini aspected by Mercury makes one skilful in producing money, always successful and inviolable king. If Jupiter aspects the Moon Gemini, one will be a teacher of sastras, be famous, truthful, very beautiful, honourable and be an elgoucnt speaker. If Venus aspects the Moon in Gemini, the person will be endowed with the company of supreme females, garlands, robes, conveyances, ornaments and jewels, and will be sportive. Should Saturn aspect the Moon in Gemini, the subject will be devoid of relatives, wife, happiness and wealth, and will be inimical to the public. Notes: Kalyana Varma states that when the Moon in Gemini is aspected by the Sun, the native will not be rich. It may be more aptly applicable when one of these two happens to be in evil houses from the ascendant or be an evil lord from the ascendant, Should they be in good house, shortage of money may not exist. Ifthe Moon in Gemini is aspacted by Mercury, the native may pursue his own profession, busi- ness etc. and will gain abundantly. The sign Gemini itself is a sign of wisdom, intelligence etc. and if the Moon posited therein is aspected by Jupiter, he will achieve great name in sastras, literatures, teachings etc, For Aries ascendant, this aspect will confer a mellifluous voice on the native and he may become a famous singer. The aspect of Venus to the Moon produces great riches while Saturn’a aspects is adverse for wealth, ara: alarenday gqgacasalfaaarasia: wlqragqa: gaa: fataafaafga: aeqaaat caret | ## Page 265 Chapter 23 261 aaa: Fanart Tagquefagifagzargara: miadlaraarittiancaea: «tras: | eT RAN 23. THE MOON IN CANCER: If the Moon is in Cancer at birth, the native will be fortunate, valorous, be endowed with residence, friends, journeys and astrological knowledge, be sensuous, grateful, be a minister, be truthful, will live abroad, be passionate, hairy bodied, fond of water and flowers, interested in construction of houses, wells etc. and will have a prominent neck. Notes: Even though the Moon may be weak, if she is in Cancer ascendant, the person will enjoy fair longevity Jambunadeeyam Ch. 1, rule 46) If she joins Jupiter in Cancer the native rules Kashmir according to classic texts, see Karkas- thita devaguro sachandro kashmira desam raja bhavati. In the modern context, if the native becomes a minister or a signifi- cant person the effects be deemed fulfilled. If Saturn aspects the Moon in Cancer, a female will have long bunch of hair. Saturn aspecting Moon in Cancer may cause occasional ups and downs in one’s career. The Moon in Cancer is generally a good position for occult studies. Now see the different effects given by the Moon remaining in Cancer for the 12 ascendants = ‘Aries ascendant : Strong Moon in Cancer is capable of conferring position with distinct identity, happiness, learn- ing etc. while weak Moon causes defects of the heart. Taurus ascendant : An afflicted Moon causes long-lasting infection, colds etc., while a strong Moon brings fame through music, gives paternal property, luck etc. and makes the native highly intelligent. Gemini ascendant: If Mars joins the Moon in Cancer, it can bring death in childhood and if Mars dasa or Moon’s dasa coincides with childhood, it is all the more certain. Full Moon contributes to lasting wealth. Cancer ascendant : If the Moon is full, the native will rise high in life and lives without obstacles. Weak Moon causes occasional downfall and eye diseases, blood disorders etc. Leo ascendant : With weak Moon, the native joins bad people while with Full Moon ## Page 266 262 Saravali he will be free from diseases, unnecessary expenses etc. and will respect other women. Virgo ascendant : The native with strong Moon will have only sisters born prior to him, will gain through good deeds and will obtain only female issues ; if Saturn joins the full Moon in the 11th the native will beget twins. If the Moon is weak ut birth, the native will not beget children and will resort to bad means to earn money. Libra ascendant : If the Moon is along with the Sun, in Sun's dasa, the native will make gains while his Moon’s dasa will give moderate results. Scorpio ascendant: Should the Moon and the Sun join in Cancer, the native will enjoy enviable position in life and will have all paraphernalia at his beck and call. Should Mars join the Moon he will have defective limbs. Sagittarius ascendant : Unless the Moon is Full, she cannot make any worthy contribution to longevity. Death by drown- ing is indicated. Capricorn ascendant: Full Moon in 7th will confer bride from known circles and in the native place of the person. Weak Moon will make the native remain at loggerheads with others, Aquarius ascendant: Weak Moon makes the native seek sexual pleasures in illegal ways and contract various venereal diseases. Full Moon proves ~ a powerful antidote against enemies. Pisces ascendant : The person will enjoy good luck, intelligence, honour, position and female issues. avafagemneed aacigad Segre atsft get cage aat cfg gid Tun qt fawaadt argeratag feareerqs fafraretfncagiaatt wat at ATS UREN afanaata aaa saafa gaatfera: Tat FATE | aaagaad qvafad 9 dteaaet REN ante qsgugad sania aa: gteadep: 1 raya gfeagurd safaaaazraararayq nett aaerTaeaa email WTA Tait HAL wees feaggt SeqIaATas BRAT URS ## Page 267 Chapter 23 263 wernge afed ages: frarqd aq afar ge: cage aitfa weit at ataq uzen 24-29. THE MOON IN CANCER IN ASPECT TO OTHERS : Should the Moon be in her house at birth and be aspected by the Sun, the native will be in the employ of king, be not rich, be a letter-bearer and will protect forts (ie will bea security officer in royal service). If the Moon in Cancer is aspected by Mars, the subject will be valorous, be deformed, will prove ominous to his mother and be skilful in his jobs. Should Mercury lend his aspect to the Moon in Cancer, he will be spirited in disposition, be endowed with political wisdom, wealth, wife and sons, will be a king’s minister and be happy. Jupiter aspecting the Moon in her own house indicates that the person will be a king, be endowed with royal qualities, be happy, will have a good wife, will behave well, be modest and valorous. If Venus aspects the Moon in Cancer, the subject will be endowed with money. gold, wife, robes and jewels, be head of prostitutes and be splendorous. Should Saturn aspect the Cancer-posited Moon. he will be of wandering disposition, be miserable, very poor, be a liar, a sinner and be mean, Notes: The Moon in Cancer in aspect to the Sua is an ideal position for national Ambassadors, employment in Defence units etc. The native may suffer occasional debacles in Defence units etc. The native may suffer occasional deba- cles in monetary affairs, If Mars aspects the Moon in Cancer, the native may lose his mother early, particularly if the aspect is from Capricorn, where Mars acquires great strength. Mer- cury’s aspect over the Cancer-Moon is favourable for political success while the spouse may face nervous breakdown, rheu- matic disorders etc. Jupiter aspecting the said Moon, except from Capricorn, confers very great wealth, fame, name etc. on the native while the aspect of Jupiter from Capricorn may give limited results if the Moon has not significant pakshabala. Venus lending aspect to the Moon in Cancer will give associa- tion with whores and money in questionable manner. However wealth will be plentiful while two marriages may be possible. With Saturn if in aspect to the Moon in Cancer, he may not achieve much financial success but will be a rolling stone. ## Page 268 264 Saravali eqarfeateatia yaaa Geaftgriage: eheat aftrramercaendtfsal ataaer: 1 arat atemniseagay faftaancfeatqasa: gaat fama: wricita: carga cae waaesiteaite: uZow 30. THE MOON IN LEO: If the Moon is in Leo, one will have sturdy bones, sparse hair, wide face, small and yellowish eyes, will hate women, will suffer from hunger and thirst, will incur stomachial disorders and tooth-decay, will eat flesh, be charitable, harsh, will have few sons, will seck sexual union in forests and hills, be respectfully disposed to his mother, will have broad chest, be valorous, dutiful and will have majestic looks. Notes : With the Moon in Leo, the native will tend to sexual union in forests/hills (or in remote places) as seeks. His voice resembles that of a lion—so majestic it he eats flesh. He may not have so good a marital front unless Venus, Sun or Jupiter comes to the Moon’s rescue. Now see how the Moon reacts remaining in Leo for the various ascen- dants prevailing at birth. Aries ascendant : The person lacks progenic ability or with great difficulty (i.e. after propitiations, medical treatments etc.) he will beget a female issue. The native may not be upto mark in respect of intelligence. Taurus ascendant : Weak Moon cannot give many brothers/sisters but will cause braindrain. Full Moon gives abundant landed property (around deserts or barren lands), Gemini ascendant : The person will have many brothers if the Moon is full. If weak, loss of co-born, lack of intelligence, burning sensation in the throat, Tonsils etc. will be experienced. Cancer ascendant : Child mortality is indicated if the Moon is weak. Full Moon confers great longevity. Leo ascendant : The native will be night-blind with weak Moon right from his boyhood while Full Moon may cause eye defects ata later part of life. However, longevity will depend on Saturn and other factors. Virgo ascendant: The elder sister may be barren while the native may be in penury fora greater ## Page 269 Chapter 23 265 part of his life. Libra ascendant: The native will spend on auspicious functions like marriage, will have a decent living and will spend away his paternal property in life time, Scorpio ascsndant: He will have loving parents, high education etc. The father may however be at loggerheads with the mother. Sagittarius ascendant : The native’s father will be shortlived while the native will be subjected to misfortunes. Capricorn ascendant : The native will not enjoy a happy married life while his spouse may not be virile. Aquarius ascendant : The native’s spouse will be sickly while his enemies will always trouble him. Pisces ascendant : He will not have healthy children, will experience miseries throughout life and will be holding only low positions in life. qofeaned Fea srayyt Agreat ateq) vat ge: fag cad feat az: uae aaraia sad acgafagariangatiiay t waageaged = -gafrasacar: = fas nan vitedt ciated eitard gafraas fee Be gta yl swgadtnfad wz naw afad gayei agad quand a gM oataged yeqeracea: faz ng smatfanadad Ufa gafraas Hea grafates srt mat get garage: wan vasa aat aet gafagedianers a sail uae 31-36. THE MOON IN LEO IN ASPECT TO OTHERS : Should the Moon be in Leo in aspect to the Sun, the native will be equal to a king, will have excellent qualities and maje- stic voice, will be valorous, be fond of intoxicants and be widely famous. If Mars aspects the Moon in Leo. he will be ## Page 270 266 Saravali an army chief will have excellent wife, sons, wealth and con- veyances and be superior among people. Should Mercury aspect the Moon in Leo one will be endowed with the chara- cteristics of a female, and also the grace akinto that of a female; will be in the custody of females, will serve females and will enjoy money, happiness and pleasures. If Jupiter aspects the Moon in Leo, one will be excellent among his castemen, be wide-famed, highly virtuous and will equal a king Should Venus aspect the Moon in Leo, one will possess a wife, wealth, and high knowledge, be sickly disposed, will bea female’s servant, and be skilful in sexual union. If the Moon in Leo is aspected by Saturn, the person will be an agriculturist, be not wealthy, be a liar, will protect forts, be devoid of happiness from wife and be mean. Notes ; If the Moon in Leo is aspected by the Sun, while the ascendant is one of Aries, Leo and Scorpio, the native will beget big fortunes. Similarly if aspected by Mars for these three ascendants. Mercury's aspect on the Moon in Leo in general is a good combination for astrology. Saturn aspecting the Moon in Leo will make the native resort to extra-marital relationship. The aspect of Jupiter or of Venus will confer wealth, eat araargefraargqgarareaarferatt faermarient faaaaga: acratasera: ate: arargaedt ofaaace: arfadhraant wammangaggates: Raat TATE uy 37. MOON IN VIRGO : If the Moon occupies Virgo at. birth, one will be addicted to women, will have long hands, attractive body and face, beautiful teeth, eyes and ears, be learned, bea religious preceptor (teaching vedas etc.), be an eloquent speaker, be truthful and pure, valorous, be kind to living beings, be interested in others’ affairs, be of forgiving disposition, be fortunate, will have more daughters but not many sons. ## Page 271 Chapter 23 267 Notes : The Moon remaining in Virgo will give varied results as under for the different ascendants : Aries ascendant : The native will loss his landed pro- perty and will incur heavy expenses on litigations. He will not be happy in regard to his mother, will suffer diseases in boyhood and will generally have limited achievements. Taurus ascendant : He will have a daughter who will become very wealthy in her life. The native will not have good terms with his friends and relatives, Gemini ascendant : If the Moon is Full the person: will have lasting maternal happiness, learning etc. If Jupiter or Mercury give company to the Moon in Virgo the person will reach high position in life and be wealthy. Cancer ascen- dant : Even the Full Moon will not. give satisfactory results if in Virgo. The native will lack happiness in every respect. Leo ascendant ; If the Moon is weak, the subject will be subjec- ted to poverty and if Full, some wealth can be expected. Virgo ascendant : The Full Moon makes the native beautiful, very affluent and skilful in speech. Weak Moon gives adverse results in her dasa. Libra ascendant : Expenses will be incurred only on good deeds while the prosperity of the native will be obstructed off and on. Helping hand can come only from Venus or Saturn. Scorpio ascendant: The dasa of Full Moon will confer abundant riches while that of weak Moon gives bad conduct, penury etc. Sagittarius ascendant : Full Moon gives association with good affairs, visits to shrines and a noble and great profession. Weak Moon gives attachment to mean professions. Capricorn ascendant : Full Moon causes wide fame to the native’s father and luck and longevity to the native while weak Moon deprives one of paternal bliss. Aquarius ascendant: The Full Mooa gives medium longevity but no physical comforts, Weak Moon makes one shortlived. Pisces ascendant: The person begets a chaste wife with Full Moon and enjoys married life. Progeny is delayed. Weak Moon is not a good augury for married life. qrataat ead alee fafrecentey ararat vfageet wraigtd ait | Fea acu ## Page 272 268 Saravali fread ward aad fafa gett ay ware gaqeel argefe = aait Hea REN wi fremrenfa fad farenaey fasted geery 1 afaad warat wage fag gafrasae: won aorta gfad qreaat adaard a wurat geet oaaafa fawarfad ara: ven wart agent fafaragrenfaareay 1 aaatkatisaghd ed aga factferaraer: wee aizeqia afed gaefganarae gafrasaq wrarat ange: eatarread = oatait Hea eR 38-43. MOON IN VIRGO IN ASPECT TO OTHERS: If the Moon occupies Virgo at birth and is aspected by the Sun, the native will be incharge of royal wealth, be famous, will keep up his word, and perform distinguished acts. If Mars aspects the Moon posited in Virgo, the subject will be skilful in mechanical or fine arts (of 64 kinds), be famous, affluent, disciplined, courageous and will be inauspicious for mother. Should it be Mercury that lends aspect to the Moon in Virgo, the native will be expert in astrology and literature, be successful in disputes/quarrels, and be highly skilful to a surprising extent. Jupiter aspecting the Moon in Virgo indicates that the native will be supreme among his relatives, be happy, will carry out royal duties, will keep up his word and will be endowed wealth. If Venus aspects the Moon in Virgo, the person will have many wives, be endowed with many kinds of makeups, pleasures and wealth and will always be blessed with fortunes. The Moon in Virgo aspected by Saturn indicates that the native will not have firm memory, will suffer from poverty, will not have happiness, will be bereft of mother, will be at the disposal of women (or be controlled by them) and will derive wealth through females. Notes : If the Moon in Virgo is aspected by the Sun, the native can occupy positions like bank manager, treasury officer etc. and will become a distinguished person. Mars aspecting ## Page 273 Chapter 23 269 indicates that the person will be an expert artist while that of Mercury denotes proficient astrologer, lawyer, literator etc. Venus lending its aspect points out to plurality of wives, more so when the ascending sign is also Virgo. Saturn’s aspect on the Moon in Virgo denotes that the person will run brothels and the like and will earn money in mean ways. sera eqraares: gaazaagy fart qareat myer: abla aranaea feerrey: fate: 1 wet 2afemai agfaaga: esitfere gtazet armadnafagiat arat ayantverdt ween 44. MOON IN LIBRA : If the Moon is posited in Libra at birth, the native will have elevated nose, broad eyes, will have weak (i.e. not prominent) face and emaciated body, will have many wives, many bulls (or cattle) and abundant landed property, be valorous, will have testicles resembling that of an ox, be skilful in work, will honour Gods and the wise, will be endowed with various kinds of wealth, will be conquered by females, will have an emaciated body (this is a repetition), will donate corns, will not be firm in disposition and will be helpful to his relatives. Notes : The Moon is capable of bestowing following effects remaining in Libra, for the various ascendants : Aries ascendant : If the Moon is Full, she may even inflict death; the native will not have freedom from diseases. If the Moon is weak, she may not pose death on the native, but the mother of the native will not be happy. Taurus ascendant : The native will have, if the Moon is Full, still troubles from litiga- tions. debts etc. though to a minimum extent; if she be weak, the subject is always subjected to miseries and inauspicious effects. Gemini ascendant : If the Moonis Full. one makes lot of money and maintains abundant savings He will have physical beauty, mental chastity etc. to full extent. If the Moon is declin- ing, loss of female issues, lack of learning, sufferances from brain diseases, blood pressure and having moderate luck should be predicted. Cancer ascendant : If the Moon is Full, he ## Page 274 270 Saravali enjoys maternal happiness, landed property, learning, conveya- nces etc. Paternal inheritance will be quite significant. He will do business across the seas and enjoy abundant riches. If she is decreasing, early death of parents, obstruction to education, running away from the family etc. can be denoted. Leo ascen- dant: If the Moon is Full, one will derive good fortunes through sisters. He will achieve fame as singer, actor etc. If she is declining, enmity with co-born, diseases of the throat, blood-clot etc. may be foreseen. Virgo ascendant : If it is Full Moon, one will amass wealth to a surprising extent, will have a beautiful face, pleasant teeth,a rich elder brother and uninterrupted gains. His Moon’s dasa will confer a supreme Rajayoga. If she is waning, there will be only an ordinary yoga. Libra ascendant : If the Moon is weak, the native’s longevity is short and he will not enjoy good position. If she is full, one becomes a very notable personage, very famous and very rich. If Venus aspects such Full Moon, the native is richer than the richest. If she is declining, the native isa ‘repository’ of all kinds of miseries, subjected to rheumatic/ blood disorders and will lose his mother very early. Scorpio ascendant : The Moon in the 12th cannot give much wealth but the native will become famous and will spend on meritorious and noble acts. If she is waning, the expenditure will be on bad deeds and one becomes illfamous. Sagittarius ascendant: If the Moon is Full, the earning will be abundant and by fair means. The person will be long-lived but will face occasional losses through theft, machination etc. If she is waning, there will not be much wealth but short-life. Capricorn ascendant : If the Moon is Full, one will be endowed with good conduct, independent profession and spiritual activities. If she is declin- ing, he will be devoid of character, will be proud and will resort to ignoble means for livelihood. Aquarius ascendant : Moon dasa can give ordinary results if she is full and adverse effects if the Moon is declining. Pisces ascendant: Same as for Aquarius. Additionally, Full Moon bestows long life on Pisces native while declining Moon will cause infant mortality. mat cfeaned ofcqd wtafasgad a1 agarat oa saat | cfeetferrrez: wen ## Page 275 Chapter 23 271 aee a ad sealfeqeanreqdgaay | afrararge? = arate a fener: ween geal gaa wa: aorfaaed syaeAeTy) guard fagid trend gat Faun Mafaagert waafa aaa gfnd fgg: aafesag gaat carfag | ase wesn afaantti gaa agafaarg aathad sta) fafactorafatast Hee yyelfa: vat gah ween wa wat ware fraaed agidd 71 fanacta gacigd wrenfcqeet fg Arg: Wyott 45-50. MOON IN LIBRA IN ASPECT TO OTHERS: If the Moon is in Libra and is aspected by the Sun, the person will be bereft of wealth, be diseased, will wander here and there, be insulted, be bereft of enjoyment, sons and strength. If Mars aspects the Moon in Libra, the person will be sharp, be a thief, be mean, adulterous, will enjoy scents and garlands, be wise, and will suffer from eye diseases. If Mercury aspects the Moon in Libra, the subject will be skilful in arts, will have abundant riches and grains, will be an auspicious speaker, be highly learned, and be famous in his country. Should Jupiter aspect the Moon in Libra, the person will be always wor- shipped, and be skilful in sales and purchases of gems etc. If Venus lends his «spect to the Moon in Libra, one will be beautiful, be free from sickness, fortunate, strongbodied, be learned, and will have knowledge of many means. Should Saturn aspect the Moon in Libra, the native will be very affluent, be sweet in speach, be endowed with conveyances, be very much interested in sexual affairs, be devoid of happiness and be favourable to his mother. Notes : Ifthe Moon in Libra is aspected by the Sun, it is inauspicious for wealth, progeny etc. But if Venus is exalted simultaneously or is in Aries (elong with the Sun) the malefie effects denoted will not come to pass but good effects will increase in these areas. Sull the native will desire frequent ## Page 276 272 Saravali changes. If Mars aspects the Moon in Libra from Cancer, the person will be of thievish disposition, will join other women and will contract many diseases. If the aspect is from Pisces, these effects will vonish and the native will be free from diseases, be virtuous and rich. Iffrom Aries, the native will however, acquire an extravagant, irascible wife whose longevity will depend on the strength of Mars. Should Mercury aspect the Moon in Libra, the native will gain paternal property which will however be spent away. If Jupiter lends his aspect to the Moon in Libra, the subject’s father will suffer from diseases while the native’s fortunes will be many. Saturn’s aspect on the Moon will make the native very rich, spiritual and philoso- phical. Gel qaiaany: afeararcagaifers: wae: ad aed wnat gafagerarareaa: waeat: weer: oegafaed arygta: se: ost UraT Eaea: TASHA: BTA aaTTAT UAL 51. MOON IN SCORPIO: Should the Moon be in Scorpio at birth, one will be a miser, will have round thighs (i.e. wellgrown thighs), will have coarse physique and nose, (ie. the physique and nose will not be soft), will be cruel in acts, bea thief, be sick in childhood, will have spoiled chin and nails but beautiful eyes, will be plentiful, be industrious, skilful, fond of other housewives, devoid of relatives, insane (or infatuated with passion), valorous, will lose wealth due to royal wrath and will have a big abdomen and a big head. Notes : The Moon when in Scorpio will be in fall and hence it proportionately reduces the potence of the horoscope. If however she occupies further favourable houses, this defici- ency is offset to a great extent. Or if she is Full or is aspected by Venus, Mercury, Jupiter or Mars, much betterment can be expected. Posited in Scorpio, the Moon can manifest the following different effects for the various rising signs. Aries ascendant : If the Moon isin Scorpio at birth, the native and his mother as well will be sick and shortlived. There ## Page 277 Chapter 23 273 will always be poverty. Taurus ascendant : If the Moon is Full, the wife of the native will be amicable, beautiful and will bring fortunes with her. If the Moon is waning, the native’s marriage is delayed and the married life will not be happy. The second issue of the native will be afflicted or short-lived. Gemini ascendant : The subject will contract several debts and will always be in wants, Full Moon mitigates these defetcs sufficiently. Cancer ascendant : The subject will suffer abdo- minal disordres. If Jupiter aspects the Moon in this case, dropsy will result and death will be caused in the major or sub periods of Moon/Jupiter. Leo ascendant : If the Moon is in 3rd degre: of Scorpio, all the good combinations and merits of the horoscope are marred and the native cannot prosper, If Rahu joins the Moon, the mother is unchaste. Virgo ascendant: The native will be deaf or will suffer from diseases of the ear. If the Moon is Full, treat- ments will be of some help Libra ascendant: The person concerned will not make any headway in profession and will face accute poverty. Scorpio ascendant : The subject will be dullwitted, foolish and poor. Sagittarius ascendant : If it is New Moon, death will take place at the age of 8. If full Moon survives the netive, he will resort to unfair means of earning and will spend away all his wealth, Capricorn ascendant : If Moon is Full, her dasa will bestow somewhat better effects but not marital bliss. If weak, there will be allround adver- sities apart from quite an unhappy married life. Aquarius ascendant: In this case weak Moon in fall in the 10th gives excellent results, abundant Luck etc. while Full Moon gives- little favourable effects, see the sloka concerned : eat qat aaet ereraasaras: coteqat abaya zt aer (with refe- rence to Aquarius). Pisces Ascendant : Full Moon gives moderate results but grief on account of children while declin ing Moon does not confer any auspicious results. gw aeied grad aa faaaed a feaneagisfrases: gaatad geeq yan aqandd gua aafaad afeas fagiegay qed mat eer fair aay: una ## Page 278 274 Saravali wagrancad aac a aftand a1 waafa gaa qe: gent gat a Mary nes . water gra cede a fanaa a geet geetsfrac) Fraratt erat ayn afaafaadta qua aaatarairaferatiag ae 1 gafafrarfraare carafe agetferrerz: wen Marea got enfeared a seat a1 WAAR ATAU RAT: ATE YOM 52-57. MOON IN SCORPIO IN ASPECT TO OTHERS : If the Moon at birth is in Scorpio and aspected by the Sun, the native will hate people (i.e. will_not be friendly with others), be learned, wandering natured, and rich but be not happy. Should Mars aspect the Moon in Scorpio, the native will have incomparable courage, be equal to aking, be endowed with wedlth, be valorous, inconquerable in battle, and be a voracious eater. If Mercury aspects the Moon in Scorpio, the person will not be skilful, be hard in speech, will obtain twins, be tricky, will produce fictitious things and be an expert singer. If Jupiter lends aspect to the Moon in Scorpio, the native will be interested in performing his duties, will be biassed towards people, be wealthy and be beautiful. If Venus aspects the Moon in Scorpio, the native will be highly intelligent, be fortunate, be endowed with riches, conveyances and beauty, and will Tose strength on account of women. If Saturn aspects the Moon in Scorpio, the native will have base sons, be a talebearer, be sick, poor and untruthful. Notes : While the aspect of the Sun on the Moon in Scorpio has its brighter side, it has its adverse phase as well in that the luni-solar relationship involving Scorpio-Taurus brings strained married life. The spouse is oftener found irascible, upper-handed and selfish. ‘The native is generally not happy in most fields except that he reaps some wealth. This is good for higher education if the Moon is beyond her deep fall zone. Mars lending aspect to the Moon adds to the ## Page 279 Chapter 23 28 courage of the person. He will be more disposed towards eating frequently hot foods. Financial achievements will be splendid if Mars aspects from Aries. Mercury's aspect takes away the self-confidence invested by other planetary combina- tions and gives problems in speech, like stammeririg. The native will indulgs in cheating, trickery, jugglery etc. He will be skilful in forgery, and will invite risk if Rahu is associated with the Moon or Mercury. Jupiter's aspect on the Moon gives physical beauty but sleader waist. This aspect may produce problems like intestinal ulcer, or indigestion etc. If the aspect of Jupiter is from Cancer/Pisces, it may result in dropsy and consequeat death. Venusiantouch from Taurus on the Moon gives abundant wealth, beautiful and libidinous wife, and business in beautifying articles, textiles, jewellery, interior decoration etc. The combination is also capable of causing imbalances in excretory and generative system. Saturn (singly) aspecting the Moon in Scorpio denies marriage altogether but the native tends to seek pleasures of sex out of the way. Ifat all marriage is granted, itis only namesake. This aspect triggers of various diseases like heart trouble, windy complaint etc. This isalso a dysmelic indi- cation. Far_l qeta: qqgeaele: dtaang: sat data east aracaafa: fafeafag qefaa: 1 Ae waisfeaerd faacagan: eqorpedtescitet waa gaat gis afrat dgarefa: sew: wysn 58. MOON IN SAGITTARIUS: If the Moon is in Sagittarius at birth, the native will be dwarfish, will have round yes, big heart, waist and hands, be a good speaker, will have prominent shoulders and neck, will live near watery zone, will have knowledge of arts and secret affairs, be courageous, wili possess strong bones, be very strong. will have strong neck and lips, be attached to his relatives, be grateful and distinguished. His legs will not be wider when in position, ## Page 280 276 Saravali Notes : With the Moon in Sagittarius, the native will be short in stature and will have a heart which will be big in size. If Jupiter is strong, the native will grow to normal size but will have a bulky physique. The Moon's placement in this sign is favourable for study of occult sciences and working in depa- ttments related to investigations, enquiry commissions etc. With reference to the 12 ascendants, the Moon in Sagittarius, produces the following effects : Aries ascendant : Though the Moon has blemish she will prove beneficial in the 9th in Sagittarius. Prosperity, luck, wealth etc. are conferred, as a consequence. If the Moon is weak, one will be highly irreligious and will not be favourably disposed to good acts. Taurus ascendant : The native will be subjected to physical distress, irrespective of the Moon being Full or New. Weakness of thighs, hips and bad lungs will result in the relative periods of the Moon. Gemini ascendant : With weak Moon, the married life will be short while full Moon gives unexpected riches in speculation, The Moon-whether Full or New ~in Sagittarius makes a Geminian prone to accidents caused by fall from height. Fear from animals, loss of memory and premature fall of teeth will follow. Cancer ascendant: One will be addicted to frequent drinking of liquor, gambling, debauchery and contracting loans, If, however, the Moon is strong, beneficial resuits will be reaped and the Person will be free from diseases and be long-lived. Leoa ascendant : Bereavement on account of children, gains from animals, husbandry etc. will result while the drak side denotes cardiac/respiratory disorders. Virgo ascendant: The person will be highly learned and will be affectionate to his mother. Libra ascendant : The native will gain in profession through his coborn. A feamle with Full Moon will have prominent breasts while with weak Moon, she will have depressed breasts. Scorpio ascendant : The Full Moon in 2nd will give excellent results in respect of wealth, patrimony etc, in her dasa while weak Moon will give ordinary results. Weak Moon with malefics shall cause c1rly death of parents, particularly father. Sagittarius ascendant: Full Moon in the ascendant can con- ## Page 281 Chapter 23 aE] tribute to moderate longevity while weak Moon Is adverse and shalll cause perennial diseases right from childhood. Capricorn ascendant : If the weak Moon is in Sagittarius, the native’s spouse will tend to live separately while Full Moon keeps the tempo soft. Aquarius ascendant : The native will be free from diseases while his children may be prone to these. Pisces ascendant : Full Moon offers exemplary and independent career and the native will leave behind a huge fortune for his cbildren, Weak Moon does not ensure cordial relationship with children and the native will be angrily disposed. aafrangd get qt faeradted arty WERENT ATA AG MAG aaTEN ATT naan aaria age gud seqradted geo) wamagrad ferfrgreg: att | agft ugoit agua salfaa freafearfatagy a1 gaecet fgacfaatcurard «gt ae nen mgreg Fw qediaaea afad arty franqeaeqiadanigqarad WR: NEN gfaradta fe afd gui gariamad a1 amt gfarard = wriagse: | aetetrg: ga fronfad gaat apyt acarfed ata) afaond qoged sata atti: aait agi ues 59-64. MOON IN SAGITTARIUS IN ASPECT TO OTHERS : If the Moon in Sagittarius is aspected by the Sun, the person will bea king, be affluent, valorous, famous and will have uncomparable happiness and conveyances. Should Mars aspect the Moon in Sagittarius, the person will be an army chief, will be very rich, fortunate, famous for his valour and will have a large working force. Ifthe Moon in Sagittarius is aspected by Mercury, one will have many servants, will be an expert astrologer and artist, and bea skilful dancer. If Jupiter aspects the Moon in Sagittarius, one will possess very attractive physique, be a king’s minister, and will be endowed ## Page 282 278 Saravali with wealth, virtues and happiness. Should Venus aspect the Moon in Sagittarius, the native will be happy, beautiful and fortunate, be endowed with sons, wealth and sexual desires and will have good friends and wife. If Saturn aspects the Moon in Sagittarius, the person will be sweet in speech, will speak good words, will have wide knowledge of Sastras, be truthful, soft and be a king’s man, Notes : The Moon in Sagittarius, aspected by Sun/Mars/ Jupiter is favourable for Sagittarius, Scorpio, Aries, Leo and Cancer ascendants. In the general context, the Moon in Sagittarius aspected by. the. Sun gives riches, fortune, vehicles etc. Also if by Mars or Jupiter. Venus aspectidg the Moon in this Rasi, though bestows excess desire for sexual connec- tions, the native shall not go out of the way. His married life will be quite happy. Even Saturn’s aspect on the Moon in Sagittarius gives good tendencies, knowledge of sciences galore, truthfulness and so on and so forth; but Jupiter’s aspect simultaneously or his conjunction with Saturn lends fortune ete. Man: Mate: qa: aaranisaat sig: earatseretat aafemage fra eeaTa eT: | aida: alae qegatara: cenfag cory nedlentglstrgea: ofits aret atermnststerwet: WKN 65. MOON IN CAPRICORN : If the Moon at birth be in Capricorn, the native will be a singer, will be averse to cold articles (or season), will have stout body, will be fond of truth and charity, be distinguished, famous, less irascible, be libidinous, unkind and shameless; will possess beautiful eyes and emaciated body, will violate teacher's bed, be a poet, will have round thighs, be not very enthusiatic, be very miserly and will have long neck and ears. Notes : The Moon in Capricorn (or in the other sign of Saturn, i.e. Aquarius) will make one susceptible to colds etc. and such people should avoid cold articles etc. and be cautious in winter in the matter of food ond other habits. Since the position of the Moon in Capricorn is otherwise a good augury, the native will receive help if Jupiter or Venus is in the 3rd in ## Page 283 Chapter 23 279 Pisces or if one of these two aspects the Moon. The Moon remaining in Capricorn will produce different effects, as under for the various ascendants. Aries ascendant : The Moon in the 10th causes Rajayoga and spiritual achievements. Such natives will head religious missions. If Saturn aspects, one takes to monkhood and is deprived of marital ties. Taurus ascendant : There will be acquisition of plenty of wealth. Gemini ascendant : If Moon’s dasa coincides with boyhood (before 12), the native may face early end. If Mercury lends his aspect, then the situation is mended. Cancer ascendant : The native obtains beautiful and amicable wife. He will be fortunate and wealthy. Leo ascendant : The Moon, if weak, brings insult/defeat from enemies while Full Moon gives association with many bran- ches of learning but mastery in none. Virgo ascendant : The native begets one daughter only. Ifthe Moon is weak, the sustenance of the childis doubtful. Libra ascendant : High position and smooth career is bestowed on the native. Weak Moon does not give a long-living mother. Scorpio ascendant : Weak Moon destroys other Rajayogas while Full Moon makes the native give away the patrimony to his young- sters. Sagittarius ascendant : If the Moon is weak, the person is shortlived while with Full Moon he enjoys long span of life. Capricorn ascendant : If the Full Moon is inthis Lagna the native will have a copulent body while with weak Moon,.he is emaciated, sick and shortlived. Aquarius ascendant : The native will be a spend-thrift Pisces ascendant : The native will obtain happiness through children. He will be fortunate if the Moon is Full. wad geared aemied aalnd HUT nat gaaaata: faeraia atfaat cfu ugen afafanangat get aadgd at gerd) aaaga owas Ulf | am fazae: ugen qa saracta wagaia asad git deat waala gaa ase: gavfad fda gery gen ## Page 284 280 Saravali qafragrrdtd qafaget: aga at oy agagaiad «oat | qeetferaeara: gant aygafaafrsmargrarantad at Ae ateataaga = waafe = ygettferrsaez: noon aad afad aad waar creative 1 faaanegagse: wit aat at AaT Wow 66-71, MOON IN CAPRICORN IN ASPECT TO OTHERS : Should the Moon in Capricorn be aspected by the Sun at birth, one will be penniless, miserable, wandering- natured, interested in others’ work, dirty and clever. If Mars aspects the Moon in Capricorn, one will enjoy abundant riches, be highly liberal, be fortunate, wealthy, will have conveyances and be brave If Mercury aspects the Moon in Capricorn, one will be dunce, be intersted in living in other places, be bereft of wife, be fickleminded and be devoid of happiness and money. Should Jupiter aspect the Moon in Capricorn at birth, the native will bea king, be uncomparably brave, will have royal qualities, and will possess many wives, children and friends. If Venus aspects the Moon in Capricorn, one will join others’ wives, be endowed with wealth, ornaments, conveyances, garlands etc., be blameworthy and be issueless If Saturn aspects the Moon in Capricorn one will be indolent, dirty, be endowed with money, be troubled by sexual feelings, will join other housewives, and be untruthful. Notes : Normally, the Sun’s aspect on the Moon in Capricorn deprives one of affluence as both these planets are not well disposed towards Saturn, the Moon sign lord. How- ever, if the ascedant be one of Scorpio, Aries, Leo, or Cancer —particularly Cancer, it brings wealth etc. The aspect of Mars on the Capricorn-Moon is very favourable for riches as Mars is unsullied yogakaraka for this ascendant. Mercury’s aspect isnot a good augury for money while it is auspicious for father’s success. This aspect gives a sickly wife. However. Jupiter’s aspect on the Moon in Capricorn tends to plurality of wives and number of children. If Jupiter falls in Capri- ## Page 285 Chapter 23 281 corn navamsa in the process the effects are only moderate. The Moon in a Rasi of Saturn and in aspect to Venus gives a tendency to be immoral but favours the native with vehicles, jewels etc. Saturn’s aspect also promotes immoral character, distress out of sexual feelings and wealth. In addition, this aspect makes the spouse prudent and loving. sare wate: qaacaral wearer: ayae erigta: Tegamre: EGA FAA: meuraeahrra fagagante: frerfearatat gaat gearat aengrrat cfszara afea: noan 72, MOON IN AQUARIUS : If the Moon is in Aquarius at birth, the person will have elevated nose, rough or uneven body, and stout hands and legs; will ve addicted to intoxicants, will be averse to the virtuous, be not himself virtuous, will obtain illegal sons, will have stout head, ugly/diseased eyes, bright face and prominent waist, be an artisan, will have bad mentality, be miserablr, and will be very poor. Notes : The Moon in Aquarius is capable of producing the following different effects for the various rising signs : Aries ascendant : The Moon produces favourable Yoga in the 11th and the native resorts to fair means of earning. Taurus ascendant : The native will resort to ignoble acts if the Moon is weak, Full Moon confers visits to shrines and all kinds of wealth. Gemini ascendant : This is a very fortunae position if the Moon is full and the native will be never in want. Ifthe Moon is with diminishing rays the native will be ominous for father and will lose his father early. Cancer ascendant : Unless the Moon is Full, one may not enjoy fair longevity but will be sickly. Leo ascendant : If the Moon is strong, the native will beget a chaste and beautiful wife and will enjoy fortunes. If weak, he will marry twice. Virgo ascendant : If the Moon is Full, th native will (at least) beget some loans; if weak even that will be difficult. So to say, his -financial condition will be awful. Libra ascendant : The native will acquire happiness through children and will enjoy power, position etc, Scorpio ascendant : If the Moon is Full, the ## Page 286 282 Saravali subject will be’a great scholar, will enjoy abundant properties, conveyances etc, and will be happy with his mother. If she is weak, these are proportionately meagre. Sagittarius ascenpant : If the Moon is full, one will have prospering sisters; if weak he will only lose them. Capricorn ascendant: Ifthe Moon is Full, he will havea beautiful face, be affluent and learned; and will enjoy favours in Moon’s dasa while it may sometimes cause death. Weak Moon does not prove a killer but gives no wealth. Aquarius ascendant: The Moon in the-ascendant is not auspicious in this case. If she is Full, the native will suffer from windy complaints and be sickly. His Moon’s dasa will not be good in effect, If she is weak, he will have crooked mind and will experience only difficulties. Pisces .ascendant : If the Moon is Full, one will be famous, virtuous and will enjoy a superior Raja Yoga. If weak, the dasa will give ordinary result and some misery in respect of children. afaaforafa a yt aed attra sftet a1 Bet | feaweagt aeqtdea: | aaTATA: WoW gist agqerdfagersd a1 faut oeatded o wtifa | wlfetreaer: now Tatras Tatas fa a gactary | agavaga ged auth galiza: salt FFA Won maaaremt aaa awrgamat a1 Feat wWihtrard ard geetfera: vat FA nog aeangaaa oo wtacaratdfafed «omit FM ait ggata faafaat aearsergaq noon wadaat afed oad a faaaiaqs eararcaritaarga mete aiteeigse: nostt 73-18. MOON IN AQUARIUS IN-ASCEPT TO OTHERS: ‘Should the Moon at birth be in Aquarius and be aspected by the Sun, one will be-very dirty im disposition, be valorous, will be ## Page 287 Chapter 23 283 like a king in guise, be virtuous, and be an agriculturist. If Mars aspects the Moon in Aquarius, one will be quite truthful, will not inherit money from mother and clders. be indolent, and mysterious, and interested in others’ work. If Mercury aspects the Moon in Aquarius, the native will be skilful in treating others well while hosting them, will be proficient in music, will be liked by the fair sex, and will possess less money and less happiness. Should Jupiter aspect the Moon in Aquarius, the native will own villages, agriculture lands and trees, be endowed with superior castles and superior ladies, and will be devoted to (sensual) enjoyments (Bhogi also means rich person or aking.) If Venus aspects the Moon in Aquarians, the person will be base, issueless, friendless, timid, be censured by preceptors, be sinful, will have a bad wife and will be least happy. Should the Moon in Aquarius have Saturn’s aspect, the native will have (prominent) nails and hair, be dirty, will seek union with other women, be a dunce, be irreligious and be rich possessing many immovables. Notes: The luni-solar aspect relating to Aquarius is generally not a good augury for wealth and other matters. The native will only be mistaken to be rich by others but will actually not be so. If Mars aspects the Moon, the Lagna being Capricorn or Aquarius, it may help the native financially and positionally. Mercury's aspect over the Moon will bring windy diseases, rheumatic breakdown, asthmatic complaints etc., monetary flow will be limited while association with females will be significantly marked. It is extremely good for the Moon in Aquarius to be aspected by Jupiter so that the native will enjoy high position, own landed properties in abundance and will be amidst superior woman (not for physical pleasures but for beneficial association). Venus aspecting the Moon in Aquarius may give some ordinary wealth but the marital sphere is severely strained. The person will be attached to whores, be not happy with his wife, will lack general happiness, will note have children and will be dismissed by his family members. Capricorn, Libra, Taurus and Virgo are somewhat better in effect if Venus aspects the Moon in Aquarius and the adverse results cited will get slightly improved towards favour ## Page 288 284 Saravali able side. If Saturn aspects the Moon in Aquarius, it will bestow great wealth and properties but will make one go after women and sexual satisfaction will be the only aimof the native. In some cases, even his spouse may not be loyal, depending on her natal Venus/Moon. faeterarfeerisiganatge: — aeafarareégh fast adfrest aggafaza: dhaara aaaat deen ago: gafafaaaare cating: aeaarat artam: agi fafagrard sitet araaita: nen 79. MOON IN PISCES :1f the Moon is in Pisces, the native will be expert in fine arts, be capable of winning even unfavourable people, be learned in Sasthras, beautiful-bodied, proficient in music, very religious, will cohabit with many women, be a polite speaker, will serve the king, be somewhat irascible, will have a big head, be cndowed with happiness and wealth, will be won over by the fair sex, be virtuous, be interested in sailing and be liberal, Notes : The Moon in this Rasi will normally give good effects, but a great deal naturally depends on the rising sign, Jupiter and the associated planets. She gives the following varied effect’ depending on the ascending sign at birth : Aries ascendant : The subject will lack maternal happi- ness, be inimical to his cousins and will spend away all his earnings, if the Moon is declining in the 12th in Pisces. Ifshe is Full, the native will be learned and wealthy while his savings will depend on the strength of Jupiter. Taurus ascen- dant : With Full Moon, the earnings will be abundant and through fair means. Even weak Moon will give some wealth but through unfair means. Generally, the native will enjoy good health, learning etc. Gemini ascendant : The native will obtain a superior profession and gain through travels. Cancer ascendant : If Moon is full, the native will enjoy abundant ancestral wealth, but will also spend in equal proportions. Weak Moon will make the native occasionally unfortunate ## Page 289 Chapter 23 285 and will bestow only moderate gains in journeys, Leo ascendant : Neither the Full Moon nor weak Moon will be in a position to confer position on the native. If this dasa coincides with boyhood, it will cause premature death. Virgo ascendant : If the Moon is waxing, the native will frequently visit shrines, will acquire a beautiful and rich wife and will beget many. daughters. Waning Moon in Pisces will delay the marriage of the native and will give a sickly wife. She will suffer bloody diseases. Libra ascendant: The native will contract heavy loans. Depending upon the state of the Moon, he will advance in his career. Scorpio ascendant : The native’s children will be very fortunate. In the dasa of the Moon, the native will propsper highly and will. achieve his life's aims. Sagittarius ascendant : The native will lose his mother early if the Moon is waning. If waxing, he will enjoy maternal happiness and acquire landed property, high education etc. and be happy. Capricorn ascendant : If the Moon is waning, the native’s wife will have defect of some limb. Full Moon gives name, fame, wealth etc. to the native but he will be timid in disposition. Aquarius ascendant : The native will incur many lossess in the matter of money and will mostly bein debts. Pisces ascendant : The native will achieve high politi- cal/business position if the Moon is strong, If weak, it will give ordinary results, Aawasart gfad aamfa aaqeq) saat faeces: ggferard vail AIA ison aftad gaced grea a infad a wagia aaa: fafagamel wa Gaz usu waafe gaa qt dlacaraaT: gen) waferita « gfad awqaftanad aaa use geet dtaedt afad araismaresfeny y wored agar agit: eitfada sag usa FM wat gett clrad Teraretaay) gafrat wordt gamete arfieitat asx ## Page 290 286 Sarayali fawanfed saat: erated gaarcafagiay gra tagaget «= atafaeargraaay sun 80-85, MCON IN PISCES IN ASPECT TO OTHERS : If the Moon posited in Pisces is aspected by the Sun, the native will be highly libidinous, be happy, be an army chiel, be very affiuent and will have delighted wife, If Mars aspects the Moon in Pisces, the person will be insulted, be devoid of happiness, is an unchaste woman’s son, will be interested in sins, and will be valorous. He will be a king if the Moon in Pisces is aspected by Mercury; will be highly intelligent, be happy and will be surrounded by supreme females and be controlled by them. If Jupiter aspects the Moon in Pisces, he will be beautiful, fierce, head of a district, be very affluent, beautiful and will be surrounded by many women, If Venus aspects the Moon in Pisces, he will be skilful in coition, interested in dance, instrumental music and songs and will steal the hearts of the fair sex. Should Saturn aspect the Moon in Pisces, he will be deformed, be unfavourable to mother, be sexually distressed, be devoid of sons, wife and intelligence and will be attached to mean and ugly females. Notes: If the Moon in Pisces is aspected by Jupiter/ Mercury the person will enjoy high position in life. If by Venus from Virgo, his married life will not be happy; he will not earn much wealth but be unhappy in all respects. Saturn aspecting the Moon in Pisces will make one go without marriage and go after prostitutes. If by Mars, his mother will be of questionable character. The Sun aspecting the Moon in Pisces denotes a person with fat body. afaaat araat cata aerate az ufrnd erg ana arersarfafiar a afar sgn 86. SAID RESULTS TO MATURE: If the lord of the Moon sign, the Moon sign itself and the Moon are all endowed with strength, the said effects (duc to Moon’s position as laid down inthis chapter) will fully come to pass. The effects will vary according to positions like debilitation, exaltation etc, (of the dispositor and the aspecting planet). ## Page 291 Chapter 24 287 Notes : For example, assume the Moon is in Aries at birth. Ifthe Moon should give full results due to her position in that Rasi, Mars should be equally strong. There should be good aspects to Aries (and the Moon). Ifthe dispositor, Mars in this case, is in fall, inimically placed ctc. the effects will be adverse. Similar estimates should be made through the aspecting planet as well. fa werrqadfaefaaral arcracat axe aor aafaatseara: UIA Thus ends the 23rd chapter in Saravali, entitled “Effects arising out of the Moon”. RY BWRATIMARNIA: ure ‘Chapter 24 Effects of Moon in Various Navamsas weit gat faadaoacer: savesa) saafa araged sasar gas fear geaq nen qin SILATAAAAATgTAF =—|-YR waa ogee? oer fageerereag in gan aifasfed wanfad edtfaacarge ate aha aga deta fadea wz nan 1-3.. MOON IN NAVAMSA OF ASPECTED BY OTHERS : If the Moon isin the navamsa of Mars aspected by Mars himself, one will win over his enemies and will be valorous; if by Saturn very cunning, deceiving and trifling; if by the Sun thief, sometimes crucl and sometimes protecting and be courageous; if by Jupiter, he will be a king, be famous and honoured by the learned; if by Venus, he will be a king’s ## Page 292 288 Saravali minis‘er, be wealthy and be fond of women and cosmetics and lastly if by Mercury, he will be a fast speaker and be fickle- minded. Notes: A clarification about aspect with reference to Navamsa is necessary here. The aspect of a planet should not be noted in the Navamsa chart but by longitudinal dis- tance, i.e. in the Rasi chart. For example, take the Moon in the navamsa of Mars to be aspected by Mercury. To fulfil this, the Moon should be in the Navamsa of Aries/Scorpio and be aspected by Mercury in the Rasi chart, Suppose the Moon is in Pisces while Mercury is in Virgo. The said Moon should simultaneously be in Scorpio navamsa, i.e. between 16° 40’-20° in Pisces and get the aspect of the planet Mercury from Virgo. In other words, Mercury need be ina certain position in Navamsa vis-a-vis Moon in specified Navamsa. Unless this aspect is properly understood, one cannot effectively and meaningfully apply the relative rules. Similar inference applies to decanate and other such sub-divisions. feat faaget alfagearaarraratery | saat gaa wal ata | Teta eu gear eased vaareafened aaferafaay | ART TaaATS arate | agua Un gaa aga fdad aaaataeiag att adatai quea aga feafa az: neu 4.6. MOON IN NAVAMSA OF VENUS IN ASPECT TO OTHERS : If the Moon is in Taurus/Libra navamsa and is aspected by Venus, the person will be happy in regard to wife, robes, food and drinks; if by Mercury he will have knowledge of playing musical instruments and be interested in dance and music ; if by Jupiter, he will bea great poet, be highly skilful in the branch of justice (or politics), be a king's minister, will enjoy sight of other housewives, be libidinous, and will have many a servant; if by the Sun, he will be a great stupid, will possess a beautiful face and will always enjoy food and drinks and lastly if by Saturn, the person will resemble a carpenter in disposition (i.e. he will be a carpenter by profession). : ## Page 293 Chapter 24 289 gaat gagez: fread ata ast waatq 1 gatadt fant fae aarareraag non aorahas quired gear aez: ofafesd areaq t wafrasene faaregat at tle ust arearieragig sia faferraafra: atta twat faerd =o weafa | qi ferararz: nen 7-9. MOON IN MERCURY’s NAVAMSA AND IN ASPECT TO OTHERS : If the Moon isin the navamsa of Mercury, (i.e. Gemini/Virgo Navamsa) and is aspected by Mercury, the native will be skilful in mechanical or fine arts (of 64 kinds), and be a poet; if by Venus he will have a broad physique, be an expert musician and will have rich knowledge of sacred passages (& C Sastra vachanam, Sruti vachanam and Smiriti Vachanam); if by Jupiter, he will be a king's minister, be a repository of good qualities, be famous and splendorous} if by Mars, he will be a notorious thief, be skilful in arguments and be fierce; if by Saturn, he will be skilful in sastras and poetry, be learned in arts and be intelligent and lastly if by the Sun, he will be successfu. in war and be famous. wait feancase: wait geagufreraadizg aamget | fagel ged frat | graft ugon attargcant auarefararearray | gau caged sateaar aqaarerey nee aqakad qd at aaa geuraatfnarars | abetarriza faarage a aAAaCATATT eM 10-12, MOON IN CANCER NAVAMSA AND IN ASPECT TO OTHERS : If the Moon is in her own Navamsa at birth and is aspected by the Sun, the subject will have an emaciated body but be free from diseases; if by Mars, he will be skilful in stealing others’ money and be a miser; if by Saturn, he will indulge in prohibited acts and will incur grief due to imprisonment, litigations and destruction; if by Venus, he will be inimical to the fair sex and will resemble a eunuch ## Page 294 290 Saravali and if by Jupiter, he will bea king’s minister or bea king himself-and lastly if by Mercury, he will be not virtuous, will sleep much and will wander at all times. ciara cage? adieu: agamcaafaaa: 1 amt fia gat da sfwat gar ue aida aaviad ead qracsd yavsaeq) gen get waafe agai ar ata aruge yeu oasegia: darted aad arsfiy ahia daferaniefagracd a fara ue 13-15. MOON IN LEO NAVAMSA IN ASPECT TO OTHERS :1f the Moon is in Leo Navamsa at birth and is aspected by the Sun.himself, the native will be short-tempered, famous and wealthy; if by Satur, he will be sinful, unkind and will kill living beings; if by Mars, he will possess gold, wealth and fame, will be honoured by the king and'be quite valorous; if by Jupiter he will be ‘either an army chief or a king, if by Venus, he will (only) desire to have children and will have (only) dead children (j.c. will have no living children), and lastly if by Mercury, he will be an astrologer, be fond of heroic history (such as Mahabharata), and will be very afiluent. qeart qeget fad qracaw fagaatiog 1 serafe eat fad eikat att: aaiaazay nee gazet greet atid ara aefera: weatard gat gifts: ade: waTTT non ae fafad: era feanceet ad sateeTy atta qaitd afafara fered ate necu 16-18 MOON IN JUPITER'S NAVAMSA IN ASPECT TO OTHERS : 1f the Moon is in the navamsa of Sagittarius/ Pisces and aspected by Jupiter, the native will be beautiful (or spotless). be liked by the king and be widely famous; if by Venus, he-will be endowed with conjugal happiness; if by ## Page 295 Chapter 24 291 Mercury, he will be jocular, be dear to the king and be an army chief; if by Mars he will be skilful in use of weapons and be very famous; If by the Sun he will have many blemishes, be famous and be subjected to accidents/calamities, ‘and lastly if by Saturn be will be akin to old men, be neglected by mighty men and be base. alten afte: got tenfad saad ati qaurenad = cated = free een atta acaftad cared eit aadaay | aru faqasite gafafrcadtica dteq Ron atta crafrea gftacafca areit aar ge: yeu eamdfred yest ged aatarery nen 19-21. MOON IN SATURN’S NAVAMSA IN ASPECT TO OTHERS : If the Moon is in Capricorn/Aquarius Navamsa and is aspected by Saturn, the native will be miserly, sickly and will have dead children; if by the Sun, he will have a few children, be miserable with disseases and be ugly; if by Mars, be will be equal to a king, be very rich, happy but unfortunate in regard to wife; if by Venus, he will be of crooked dis- position. be attached to women and be valorous; if by Mercury, he will be interested in liquors, and will have bad history; and lastly if by Jupiter, he will be devoted to his own work and be great. aitaa carla aeateraine @ efeenery 1 ge wet tacd fartla earafreemery uaa ufaad ag gt ga: wfad oe: eget) aeq fade geet aeaafadett vata naan sateaaea 4 oa fafafra atasenie afaanta qaaad: sora arreqacafia nevi 22-24. SCOPE OF EFFECTS : If the Moon is in ‘Vargothama Navamsa, own navamsa or other’s navaitisa, the effects will be full, medium and minor respectively. This does not apply to cvileffects, so to say these'will be reverse. If ## Page 296 292 Saravali the Navamsa lord is stronger than the Rasi lord, then only the effects due ‘to navamsa Jord will come to pass, i.e. the Navamsa effects due to the Moon will be felt as against that of her Rasi position, So say Vriddha Yavanas, afa searyadfacfaarai arcacat waves axa arr aafasitseara: navi Thus ends the 24th chapter in Kalyana Varma's Sarayali entitled ‘Effects arising out of Moon's position in various Navamsas’. wy WAATA: URI

Chapter 25 Effects of Mars in Various Rasis aod weaae: Ye: feafattsaar waaeret alganaifacaraggeaageanta: ua waft aaa: wyatisarfaaraac: 1 wie fea savst aggafaeat wagea: MAU 1-2. MARS IN ARIES : If Mars at birth occupies Aries, the native will be splendorous, truthful, valorous, be a king, be fond of war, interested in adventurous acts, be an army chief, or head of a village or a band; be delighted, charitable be endowed witha number of cows, goats ete, and grains, be fierce and will join many women. Notes : Mars remaining in Aries will bestow varied results as under for the different ascendants at birth : Aries ascendant : Mars in Aries asascendant gives physical distress. The dasa of Mars will give ordinary results as he is simultaneously the lord of the 8th. In the second half of Mars dasa, more adverse results will be felt, equal to death. Taurus ascendant : The person will contract heavy debts, will spend ## Page 297 Chapter 25 293 more on evil fronts and will lose his landed property ctc. Gemini ascendant : Mars in Aries will produce a splendid Raja Yoga conferring landed/housing properties and co-operation and help from brothers etc, An adverse Mars can cause loss of issues or may give disobedient children. Cancer ascendant : The native will amass wealth and lands and will acquire prominent position in fields like Police, Defence etc. This isa good position to run sales of animals, dairy products etc. Leo ascendant : Mars in Aries will cause distress in regard to father. If father and son both simultaneously run Mars dasa, death of father will take place. The native will however be wealthy with occasional misfortunes. Virgo ascendant : The subject will undergo various difficulties in life and will not attain success in financial matters. Depending on Venus, his marital life will be prosperous. Libra ascendant : Though the person will earn riches during Mars dasa, he will not be free from marital inharmony. Sometimes, marital life may be short. Scorpio ascendant : The native will, according to one authority, have more enemies, more debts and more diseases. (According to what I have noticed, Mars in 6th in Aries will cause physis cal defect, make one a debaucher and successful over enemies. He may be subjected to diseases, like piles.) Sagittarius ascendant: Though the native will attain great prosperity, lands etc., he will not be free from worries on account of children. His retaining a living child is doubtful and dependant on Jupiter. Capricorn ascendant : The native may be separated from his mother but will have longliving mother. He will earn abundant money and gains. His education may be disturbed. Aquarius ascendant : He will grab some property of his brothers or may lose coborn. In courage, he will be like a lion. Pisces ascendant : Mars dasa can give beneficial results while peace in family is scarce. RredtarryRt: TART | ARAAGA gato agazaatt fearafeafafagiara wan meaaaatel aggeerar: FR Feuer agiaca: ait awyfaea: gare uw ## Page 298 294 Sarayali 3-4. MARS IN TAURUS : If Mars is in Taurus in. a nativity, the person will break the vows of chaste women, will eat voraciously, will have little wealth and few sons, be jealous, will maintain many people, will not trust others, will play, violently, will speak, very harshly, be fond of music, be sinful, be inimical to relatives and will bring infame to his family. Notes : Depending on the ascendant at birth, as under, Mars in Taurus will manifest following different effects : Aries. ascendant: Loss of children and blemishes respect of wife will result. Taurus ascendant : The native wi suffer. from, smallpox and will never be happy. Two marriages are indicated. Gemini ascendant : The native will be troubled on account of debts. He will contract many. secret diseases, and will have fear of enemies. Loss of wife and loss of limbs may,also come into effect. If a malefic is associated with Mars.in. Taurus a Gemini native may even be imprisoned, Cancer ascendant : The native may have abundant earnings but all-by. unfair means. Leo ascendant : He will enjoy position, happiness and pleasures. Virgo ascendant: His good fortunes will be ordinary and he will ‘suffer from paternal grief. Libra ascendant : The native will not beget children, He may lose his, wife quite early. His own longevity is doubtful and death will; be violent in nature. Scorpio ascendant : Marital life. will be happy though the wife may suffer from frequent. sick- ness. If Venus is. strong, the wife may notbe subjected to illhealth. Occasional financial losses will be experienced. Sagittarius ascendant : There will not be amicability with. children and the native.will not be happy in this field, There, will be burden of loans, litigations and expenditure. His. fortunes are quite obstructed. Capricorn ascendant: The native will become rich and will experience allround gains while diseases of the stomach will prevail. Frequent abortions will be the order of life for a female with this position. Aquarius ascendant : If Mars is in Taurus at birth, the native will be inimically disposed to his mother. Immovable properties will be abundant while learning will not beso. Pisces ascendant : He will’ only acquire an ordinary livelihood in life. ## Page 299 Chapter 25 295 are: waaigogagad: areafefafaga: 1. aatinereara a faget agat fatarrarca: wa wind faguafigagge: ag deat ae fagaea fafagt vafa sgefrarq ca: ue 5-6. MARS IN GEMINI: Should Mars be in Gemini, the native will be spleadorous, be capable of enduring miseries, be very learned, be wellversed with poetical rules, skilful. in various kinds of fine arts, fond of going to foreign countries, virtuously disposed, highly intelligent, favourably disposed to his sons and friends and will devote to various kinds of assignments. Notes : Mars in Gemini will produce the following effects for the different ascendants : Aries ascendant : Mars dasa will in the beginning give good results while in the later half, goods will be marred. Taurus ascendant : The native will lose coborn, will have sickly wife and will incur loss of lands. Gemini ascendant : He will be of malignant disposition, will not be kind to anybody and will always be distressed due to physical ailments. Cancer ascendant: The native will getinto bad people’s association and will indulge reckless loans. In Mars dasa he may lose his’ eyes. If Saturn is. in the 12th along with Mars, imprisonment wanderings etc. will result. Leo ascendant: He never will attain high success in- independent profession, business and! the like, Virgo ascendant : There will be frequent disturbances or changes in one’s career. The good aspects depend on Mercury, Such a native will however be a very important person in his family. Libra ascendant: In a female’s chart, this position will make her go out of marital bonds and be not loyal to her husband. In. general, this will detract the element of fortune. Scorpio ascendant : The native will always suffer from diseases, will not be fortunate and will be short lived, Sagittarius ascendant : The native will obtain an extravagant and disobedient wife and,willlack happiness both in respect of marriage and progeny. Capricorn ascendant: Rhuematic disorders, litigations on account. of properties and. ## Page 300 296 Saravali final success will result. Aquarius ascendant : The native will beget children but will lose some of them. He will however be foolish. Pisces ascendant : Inheritance and gains through enemies or cousins will manifest while learning, maternal happi- ness and properties will only be ordinary. If Mars dasa occurs in life, these results will improve greatly. qayghareitet aacaeiza: pleas art a cenitrraetcg: reqgraralt wont afaarraat evar ga: gay Zander ween fafaart waft ag: adat da: usu 7-8. MARS IN CANCER : If Mars is in Cancer at birth, the subject will like living in others’ houses, be deformed, sick, will attain riches through agriculture, will enjoy royal food and robes during childhood, will eat food in others’ houses, will become wealthy through the source of water, be repeatedly anguished and be always distressed. Notes : Mars in Cancer js generally found not congenial for maternal happiness. The native will be brought up by other relatives. Though the text says that the childhood of the native will be bappy, in actual experience it is found to be reverse. So to say, Mars in Cancer does not give good results in early life but in later part. Depending on the natal ascen- dant, this planet in Cancer will give following effects. Aries ascendant : There will be little happiness with Mars in the 4th in Cancer. The native’s mother may be short lived; otherwise separation or misunderstanding will follow. Taurus ascendant : Sickness of wife, loss of co-born and courage and litigations of property will come to pass. The native may have afflicted thyroid glands. Gemini ascendant : Penury, loss of wife, loss of position and fame, contracting facial diseases etc. will occur. Cancer ascendant: The native will be groti- sque and ugly in appearance, will suffer planetary blemishes in boyhood and will lack physical comforts. Brain tumours, lack of intelligence, company with mean people etc. will also be experienced. Leo ascendant : The native will not possess any ## Page 301 Chapter 25 297 wealth, However, if Saturn joins Mars in Cancery a Leo native will obtain a Rajayoga pcr excellence. Virgo ascendant : The native will have a very small family. He will lose elder brother coupled with money. Libra native : Mars in the 10th in Cancer will adversely affect his career. He will not have any permanent and happy job to do. Patrimony will be misused. Scorpio ascendant : Paternal bliss, good fortune, understanding with co-born will all lack while diseases of the anus (like piles) will exist. Sagittarius native : The native will be absolutely shortlived; otherwise, he will lack progeny, will spend secretly on evil affairs and will be a profligate. Capricorn ascendant : The native’s wife will be weak in con- stitution and will house diseases, particularly vaginal. He will not have any good relationship with others and will frequently contract losses in h’s undertakings. Aquarius ascendant : The native will be timid in disposition. He will have a checkered career. He will be irreligious in all his acti- vities, Pisces ascendant : Though the native will experience great Rajayoga effects, he will be worried in respect of children. His mental disposition will be akin to that of a very miserable person. Ifa female has Mars in Cancer in the Sth, abortions, discharge of the vagina and such other disease will come to pass. The effect due to Mars as above will be greatly modified due to the Moon’s strength simultaneously. Hence a literary application is unwarranted, RAE TASYL: TAMAS TET: | nediraramganiacta: eargaraAaIe: nen sarge A SAAT TH EARTA | Wa gt qaet: featea: erageried uizon 9-10. MARS IN LEO : If Mars is in Leo ina nativity, the native will be impatient, be valorous, intent upon grabbing others’ money and children, will like to live in forests, be fond of eating cow’s fiesh (or beef etc.) will lose his first wife, w ll kill snakes and animals, will be bereft of children, be devoid of charitable acts and be always active in his jobs, ## Page 302 298 Saravali Notes : Mars in Leo is quite favourable for money. However, progeny will’ be affected adversely. The native will advance in marital sphere provided Venus/7th lord is suffici- ently strong. Mars remaining in Leo will give the following effects depending on the rising sign : Aries ascendant : Progeny is doubtful for the native. Ifat all he obtains one, he will-be happy with. his child, Taurus ascendant: The person with Mars in Leo will not achieve any branch of’ learning sati factorily. Though he may acquire immovable properities, due to other Yogas. in the horoscope, he will have some losses. Gemini ascendant : The. effects of Yogas in Mars dasa will only be ordinary. The native will not be will disposed towards his, father while his father may be subjected to many diseases. Cancer ascendant : Plentifulness of money, respect, excellent career will be experienced. The adverse side of the nativity willbe: unhappiness in family, lack of marital/progenic bliss.. Leo ascendant : The native will enjoy. little physical comforts:while splendid effects in the matter of prosperity will be.obtained:in, Mars dasa. Virgo ascendant : The. native will lose some limb in Mars dasa. If a malefic be with Mars in Leo, difficulties like imprisonment, heavy debts etc. will follow. He willincur the wrath of the- government, become infamous and will meet a cruel end, Libra ascendant: He will gain through marriage. The spouse will be of disagreeable disposi- tion: Scorpio ascendant : He will be. of medium. stature, will! sometimes lose and sometimes gain, will contact bloody/cardiac: diseases and will not, make. much progress. in education. However, his Mars dasa will confer abundant prosperity. Sagittarius ascendant : Lack of paternal bliss, loss of or misuderstandings; with co-born, deafness etc, will follow, Capricorn ascendant : The native will lose his wife or will not be happy in marital’ life, will be shortlived and will incur huge loans. Aquarius ascendant: Though the- wife will be rich, marital felicity will be a scarcity. Pisces ascendant : Many Rajayogas will become defunct in the dasa of Mars. If,Rahu isin the 6th along with Mars, vital organs will be spoilt. ## Page 303 Chapter 25 299) qea: aarefaaat: <fadtaet. qefraritat 1 fafaacaatsersitat faery wale saitaatedea ug aaristeadtedarfaadary aagfrer: 1 arava qeta | earafaerarce: BTA: UeN 11-12. MARS IN VIRGO : Should Mars occupy- Virgo at birth, the subject will be worthy of honour, be ever rich, be very fond of sexual union and music, be soft and sweet spoken, will. have various kinds of expenses, be not: much valorous, be learned will have ribs in their advanced position, will fear enemies very much, be skilful in sastras and fine arts, be fond of bathing, make-up etc. and be splendorous. Notes : Mars in Virgo will produce the following effects for ihe various ascendant : Aries ascendant : Marsin Virgo will make the person sickly, shortlived, poor and liable. Taurus ascendant: a female with Mars in Virgo will suffer from secret diseases, abortions, surgical deliveries etc. If Mercury is there along with Mars, she-may beget twins. One with Mars in Sth will lose children, will lack amicability with wife and children and will always invite quarrels with others. On the whole, this position of Mars will promote diseases,of the abodmen. Gemini ascens. dant : Ancestral properties:will be at stake; the native will not: attain high education and will face risk from vehicles. Cancer: ascendant : The native will have high achievements in comme+ reial activities. Progeny may lack if Mars has no apprecible- strength. Leo ascendant: There may be two marriages for the native. He will. inherit huge paternal property, but will, lose the same soon if Mercury is simultaneously in Pisces. Virgo ascendant : He will face all kinds of evils and be sickly. Libra ascendant : Loss of wife, venereal diseases, loss of money cic. will come to pass. Scorpio ascendant : The native will be, the eldest issue among the survivors. He will take to evil means toearn money and will earn plentifully.. Sagittarius, ascendant : The native will author books (particularly scriptures and will be an exponent) and will become very famous, in Mars dasa. He will obtain only one-but good son. Capricorn, ## Page 304 300 Saravali ascendant : Paternal bliss will lack. Landed property, educa- tion etc. will be in abundance. Fortunes may be obstructed if Saturn or Venus is not helpful to Mars. Aquarius ascendant : ‘The native will always be miserable. He will enjoy lapsed longevity. Pisces ascendant: In Mars dasa, there may be difficulties in married life. If Venus is not favourable then separation, divorce or death of spouse will result. aeafaca: Fromraearaa feReaA: AAT: | ary: eae: TEMA: getaw | ugg atfaggs fart | aataY aeeqdarera | afrentear irae cemreraraaeg teria A gen 13-14. MARS IN LIBRA : If Mars occupies Libra in a nativity, the person will be liable to wandering, will indulge in bad business, be an able speaker, be fortunate, deformed in respect of some limb, will have few relatives, be fond of wars, will lose his first wife, will deal in liquors and will earn through prostitutes to only lose. Notes: Mars in Libra will give the undermentioned results for the various rising signs at birth : Aries ascendant : Though Mars is the lord of the ascen- dant, if he be in Libra, he will cause imbalances in married life. ‘The native may lose his wife early. This position also tells upon other yogas in general. Taurus ascendant : Here Mars acts on the marital front in still worse a manner. Apart, the native will suffer from everlasting diseases, inimical activities etc. He will spend on immoral purposes. Gemini ascendant : Progeny will be delayed while a female in parti- cular will suffer from menstrual disorders. She will not be chaste in disposition. Cancer ascendant : Mars in Libra con- fers Raja Yoga and position on the native. He will have many female issues, Leo ascendant : Mars does not cause any good yoga in his dasa, There may be loss of co-born and litigation with them, Virgo asceadant : The native will be poor and will suffer many adversities in life. His marriage will be not ona happy note. In Mars dasa, the wife will expire, or be separated. Libra ascendant: The native will lack physical ## Page 305 Chapter 25 301 comforts and will suffer urinary disorders, He will not have good terms with his mother and will have obstructed learning. Scorpio ascendant : The native will spend away all the earnings and be indigent. His expenditure will only be on evil sphere. He will lack understanding with his co-born. He will anyhow be free from debts. Sagittarius ascendant : He will gain through females and will have only one male issue. He will become rich through independent business. He will hove male issue. He will become rich through independent business. He will maintain secret relationship with women other than his wife. Capricorn ascendant : For this ascendant, Mars in Libra will confer fortunes, high position, wealth, weapons etc. The native will be sometimes soft and sometimes illtempered, Loss of progeny will be experienced. Aquarius ascendant : The native’s father will be a profligate. ‘The native will attempt at spiritual success but will only fail. Pisces ascendant : Fall from position, loss of honour, litigation etc— allin Mars dasa—will be experienced. Though the native will not make much advancement in money matters, he will be capable of producing money on loans. earTeafeaeracagertag: fearfrgar: 1 adamant agar a aces: neu meanigegia: sqant afagaqadte: 1 afwat oo yga — fanrfiereaacizata: uegu 15-16. MARS IN SCORPIO : If Mars occupies Scorpio at birth, the native will be attached to trade, will be interested in vedic knowledge, be leader of thieves, skilful in his duties. be interested in wars, be highly sinful, will do big crimes, will be perfidious towards his enemies, will betray, be disposed towards killing, be unhelpful, be a talebearer, will be endowed with lands, sons and wife and be troubled by poison, fire, weapons and wounds. Notes : When Mars occupies Scorpio, the person becomes adept in trading or in pursuing independent profession. He may also acquire deep knowledge in archaic branches of ## Page 306 302 Saravali Knowledge like Vedas. Ifthe planet is adverse, one may take to thieving which is particularly true in the case of an Aries nativity, for Scorpio is the 8th from the ascending sign. ‘Interest in wars’ as given in the text may turn out to be interest in quarrel, fighting etc. Snake bite, electric shock, fire accident and such other calamities may occur in his life. If Mars is in this position in 22nd decanate, it may even cause death through any of the above cited means, The sative will enjoy landed property, wife and sons. If Scorpio happens to be the 7th house, i.e. Taurus ascending at birth, Mars in Scorpio does not hurt the sphere of marriage, vide Bhavartha Ratnakara, One the other hand, he proves auspicious. Natives with Mars in Scorpio may well become police officers, fire brigadiers, chemists, ininers, weapon dealers aiid 80 on and so forth, which however depends on his relationship with the Lagna and its Lord. If he is adverse, these spheres be better avoided, Now see how Mars in Scorpio proves to different nativities : Aries ascendent : Though the longevity may be fairly long, the native occasionally faces ups and downs, Financial emergencies, losses etc. are not ruled out. Married life will be blowing between hot and cold. If Venus is not favourable, even loss of spouse may take place Taurus ascendant : A Telugu canticle however says that Mars in the 7this not favourable. But in actual practice, more weight may be given to the view of Sri Ramanuja’s Bhavartha Ratnakara, The native’s spouse may bring fortunes also. Gemini ascendant : Elder brothers/sisters may not be well-disposed towards the native. The native will have expenditure on vices but may prove lucky to father. Cancer ascendant: Though Mars is capable of bestowing best results in his dasa in respect of position, lands, housing property, real estate business etc. ctc. the person will suffer on account of children, may incur stomachial disorders, digestive problems etc.. He will be fiery in disposition. If Mars occupies good Navamsa position, the native may become a famous author on subjects like chemistry, surgery etc. Leo ascendant : This isa very fortunate position of Mars for a Leo native to have abundant landed properties and the like. If Mars occupies debilitation/adverse Navamsas, ## Page 307 Chapter 25 303 the person “is ‘susceptible to enmity with mother, may have impeded learning and ‘the ‘like. If Ketu joins Mars in'this sign, the native enjoys very best results in the matter of pro- fession. Virgo ascendant : The native will become wealthy and will possess landed properties. He may have one younger brother/sister only. Libra ascendant: If Mars in Scorpio is aspected by Jupiter, both of them being adverse for this ascendant, the native’s longevity will stand reduced ‘con- siderably. Saturn's strength or that of Venus may prove a powerful antidote in that case. Mars in Scorpio while Libra ascending denotes two wives or loss of wife in the latter-part, Scorpio ascendant : The planet ‘Mars gives a wounded body. Scar/wound on the head may particularly be noted. This position gives two wives and addiction to other women. ‘Though the'native may enjoy fairly good health on’account of Mars occasional breakdown will be experinced. Diseases likely to occur are : venereal, poisonous, bloody etc. ‘Sagi- ttarius ascendant : The subject will be unhappy with children, be a miser, will not enjoy happiness in marriage, arid will ‘not be loyal to marital ties. Capricorn ascendant : Mats in 11th in Scorpio will give abundant education, landéd/housing pro- Perties, plenty of wealth, wide fame, freedom from ‘érimity, ‘and famous but shorilived children. Aquarius asceridant : The native will obtain very ‘enviable ‘position in life, be very affluent and learned. He will achieve fame ds an exponent of high latitude. Pisces ascendant : Paternal bliss may be a rarity in life but the native will make enough money and be generally happy. agha: ad: garg? facscaraa: ats: Tere: | carsratfattet war aeareatsa ota ON fageriza afer: qwrt Aarerqefaa: 1 wiindet as quam: gar waft uecn 17-18, MARS IN SAGITTARIUS : Should Mars be in Sagittarius, the native will have many wounds, be emaciated, be harsh in speach, crafty, alienated, be a warrior endowed with chariots, elephants and armymen, will pass arrows on ## Page 308 304 Saravali others’ army from his chariot, be happy with hard work, will lose his happiness and money due to anger and will not honour elders. Notes : Kalyana Varm1 hints at the bravery and skill of a native with Mars in Sagittarius in war-field. We may take it to be a favourable position for military men efc. instead of literally interpreting as given in our translation, The native will be highly industrious, cunning, harsh in treatment, will have an afflicted body if not literally a wounded body and his own anger will cause his fall. He wilt not have good relation- ship with his elders (like parents) and be unhappy. This planet in Sagittarius will produce the following general effects for the 12 different ascending signs : Aries ascendant : The native will be very. famous and will enjoy position. He may not be however free from misfortunes in respect of mother and co-born. If the Moon and Mercury are strong enough to counteract the evils of Mars just men- tioned respectively, some relief will be sure to follow. Taurus ascendant : As lord of the 12th, Mars in the 8th will contri- bute to the native’s longevity. This cannot be a sole factor, however, to reckon with, while the strengths of Saturn/Jupiter are more important. The native will beget a stout wife who will have an upper hand over him. His life will be miserable. Gemini ascendant : Mars in the 7th will tear of the married life into pieces, Such a native better not marry before 30 and better not with Mars dasa to come inthe way. He himself may be shortlived. His brothers will evolve dirty plots against him. Cancer ascendant : The subject may achieve high position coupled with serious fall some time or the other. Progeny will bz many if Mars is favourable in aspect to Jupiter or the Moon. Should Mars be otherwise, weak etc:, death of children, mental diseases, financial losses and the like will manifest. Leo ascendant : The native will have brave and honourable sons (female issue is rare with this position) and will be a worthy exponent who will leave an imperishable mark behind him. He will be posthumously famous. While alive, he may not enjoy much of due fame. Should the Sun aspect Mars, the native will be a highly placed posited politician or ## Page 309 Chapter 25 305 army official and will enjoy great and wide respect in life. Virgo ascendant : The native will enjoy sexual pleasures in unusual manner and in deserted/lonely places. His co-born will be more attached to mother tha. he could be. The mother may be shortlived or may face marital discord. Libra ascendant : Mars promotes the life span of the native and he will be very long lived. He will receive great help through in-laws, Scorpio ascendant : Goddess Lakshmi will smile on him for ever. The native may face affliction of sight, teeth etc. He will have big and protruding teeth while looking younger than what he is. Sagittarius ascendant : Weak body with wounds, frequent accidents/falls, spiritual attempt with failure, expenses on litigations, marital estrangement and the like will be the order of one’s life (with Mars in Sagittarius ascendant). Capricorn ascendant : This position of Mars will make many other yogas defunct and the native will ever suffer from miseries. He will be a synonym of misfortune if not helped by Venus. On the other hand, if Venus gets caught by Mars from Sagittarius, a Capricorn native will land in much more adversities. Aquarius ascendant : Almost similar results will be felt as by a Capricorn native, but an Aquarian is slightly better with Mars in Sagitt- arius. He can look forward to betterment in the later part of life. Pisces ascendant : The native will be lucky in all respects, will be very rich, will enjoy numerous conveyances, landed properties and will be very respectable. aa faargat aawinaafadt wafa ara: aerafa: sear: Bararat ated ar gen aaadt wrfaat caagiaaafead: cara | areas: aaa: FH eaGEN agIAIeTa: Ron 19-20. MARS IN CAPRICORN : If Mars is posited in Capricorn at birth, one will be wealthy (or fortunate), be endowed with happiness and pleasures, be wealthy, will have an excellent disposition, be famous, be an army chief ora king, will possess a good wife, be successful in war, will live in his own country, be indzpendent, be a protector, be virtuous and will be interested in various procedures. ## Page 310 306: ‘Saravali.) +» Notes.: Mars in Capricorn will confer courage, success - over enemies, high achievements in fields of army, chemical dealing, gunnery etc. Native with Mars in this position with good lordship will acquire immovale properties, For different’ ascending signs, Mars remaining in Capricorn is capable of beétowing following effects: Aries ascendant: The lord of ene in loth ir in exes. tafion Mars- will. pave way for obtaining high professional success, fame etc. Being the lord of the 8th it not only:makes - the native long-lived but also gives a huge paternal inheritance. Taurus ascendant : Father’s longevity is cut short unless Saturn is well aspected. Independently Mars can cause sickness to-father. The native flourishes through marriage.. Gemini ascendant : The dasa of Mars will pose unexpected dangers to the native and throw weight on account of litigations. Loss of » money and displacement will also result. Sickly wife, strained marital relationship and landed properties by making debts: should also be predicted. Cancer ascendant: Though Mars in Capricorn will give a superior Rajayoga to the native, early demise of the spouse will follow. Leo ascendant : Many gains through cousins and enemies will come to pass. This position may also cause wounds to father, high education to self but with some hindrance, long living mother etc. Virgo ascendant : Loss of children, gain through brothers and friends.and-a long: lease of life to the native will result. In the process, if Mercury and Saturn are both weakly posited, then Mars alone cannot give long life. Libra, ascendant : Financial plentifulness, fortunate spouse, high learning, abundant landed property etc. will be resultant through Mars in’ Capricorn. (If Venus or Saturn aspect Mars, these indications will still be greater.) Librans with Mars in’ Capricorn will have two marriages if Venus is in Gemini/Sagittarius. Scorpio ascendant : Though Mars is, the. ruler of the. horoscope, goods derivable during , Mars dasa, will only be, meagre. The. native will enjoy high , physical stamina but will-be prone to many diseases. Sagittarius ; ascendant : The subject will have numerous children, majority. : being female, and will. substantially gain monetarily. - He.will be irascible. Even with plenty ,of resources, .-he will lack: . ## Page 311 Chapter, 25 307, happiness. Capricorn ascendant :, The native, will, live in aristocratic circumstances, will lack physical happiness, be highly short-tempered, be not virtuous and will always be after other women. Aquarius ascendant : Though the , subject will have all paraphernalia, occasional downfals will crop up. Too much of expenditure will mark the life. Pisces ascendant : Fear from theft, loss of wife, huge gains will come to pass. 7 saattafagt =o gamer: = agifadziy areaatqarqaanalacagartsa URI teat fasat aarareaad FaqaT: 1 gaangadta: wasfadat: se EAU, 21-22. MARS IN AQUARIUS: If Mars is posited in Aquarius at the time of one’s birth, he will be devoid of both - affection and purity, will look like an old person, will die’ a bad death, will .have spite, jealousy, untruthful disposition, afflicted speech. and lost ‘wealth, -will-be ugly, will have (abundant) hair on the body, will lose money'in gambling, will be unsightly, will have miserable profession, be fond of liquor and be unfortunate. Notes : Mars posited in Aquarius will deprive the native of kindness, chastity etc. . Though Mars reflects youth in one’s appearance, in this Old Man’s sign, only aged traits will be acquired by the'subject. * Death will be ‘violent if particularly Cancer ascends with Mars in Aquarius. Gambling, misfortune addictability to intoxicants, adversity in profession etc. will be experienced. | Remaining in Aquatius, Mars gives the following effects for various signs ascending. . a Aries ascendant : Mars in Aquarius will prove a source ° i , The ‘native will have only one elder brother.” ‘Taurus ascendant : Education will be hindered, with Mars in The subject will, have falls from, heights and con- veyances. Loss of children, gain through’ wife, heavy expenditure etc. will follow. In female's chart, when Taurus rises with Mars’ placed in Aquarius, menopause will appear at.am unusual age, Gemini ascendant :- The native will not:! ## Page 312 308 Saravali have good terms with elders and co-born. He will be unlucky and unhappy. Cancer ascendant : Longevity is cut short wit’ life becoming miserable. Not many children are indicated. Leo ascendant : The spouse will be of questionable character and be highly libidinous. Marriage may however bring for- tunes, Virgo ascendant : The native will be long-lived, free from diseases and will prevail over his enemies. There will however be no understanding with co-born. Libra ascendant : The native’s marriage will be delayed; lack of happiness with wife and separation from wife and children are denoted by this position of Mars. The spouse may be sexually cold. For females, puberty will be delayed. Scorpio ascendant : While landed property and learning may be abundant, the subject will not be free from high incidence of debts, Sagittarius ascendant : The native will be cunning and miserly and will grab the wealth of his co-born, He will be short of hearing. Capricorn ascendant : No matter how big may be the earnings, this position of Mars warns heavy financial losses. The subject will also face loss of progeny. Aquarius ascendant : The native will be active, irascible, unhealthy and profligate. Pisces ascendant : There will be loss of paternal wealth and high dose of expenditure. tat weaa: saree: raaqaicaa: 1 HTaTaSaaalaes aaaeay faqrat AURA faatsfactemaitet gefgaranat aargta: 1 Staaten atat eofafiatsed ge cara: nae 23-24. MARS IN PISCES: Should Mars be in Pisces at the time of one’s birth, the person will be troubled by diseases, will have indifferent children, will live in foreign countries, be insulted by his own relatives, will lose all his wealth by his cunning and cheating disposition, will be depre- ssed in spirits, be very miserable, will disrespect elders and Brahmins, be unkind, will conceive (other's) desires, be fond of praises and be famous. Notes ; Mars in Pisces will make the native timid, less friendly and spiritless. There is a likelihood of his losing ## Page 313 Chapter 25 309 wealth by his own evil thoughts. For different ascendants, Mars in Pisces will produce the following possible effects : Aries ascendant : The native will be subjected to all kinds of miseries with Mars in the 12th. He will have fear of drowing. Taurus ascendant : There may be two marriages to the native. (This is sure if Venus is simultaneously in Virgo). Gains will accrue through unfair means. Gemini ascendant : The person will not be in good terms with employers and will have checkered career If Mercury aspects Mars, favourable results will follow. Mars in 10th will make a Gemini native a source of trouble to others and pitiless, Cancer ascendant : ‘The subject will lack paternal bliss. He will earn through watery products, gold, electricity, teaching, banking etc. Leo ascendant : One will inherit money through father only to spend away a major protion. Maternal happiness will bea rarity, Educational aspect will be strained. Much duress will be experienced during boyhood. Many diseases will occur throughout life. Virgo ascendant : This is not a happy position to have a long-living wife; During Mars dasa the spouse is prone to accute danger. The native himself will be frequented by ies and misfortunes. Libra ascendant : Diseases like dropsy, indigestion, burning sensation of digestive organs etc. will be the order of one’s life. Penury will be markedly experi- enced during Mars dasa. If Mercury is exalted simultaneously inthe 12th a superior Rajayoga is constituted promoting fortunes and fame. Scorpio ascendant : The native may aquire children but will lose. Occasionally unhappiness will be felt. Sagittarius ascendant : One will have mother of questionable character unless Jupiter is auspiciously posited. The position of Mars in Pisces also indicates a shortliving mother. Capricora ascendant : The subject will be brave, will encounter fraternal loss/wrath and will be ordinarily happy. His mother will be attached more towards his co-born than to him; Aquarius ascendant : One may lose either wife or children. Though Mars isa Rajayogakaraka, the 2nd house position does not promote frugality. Pisces ascendant : If Mars dasa occurs in childhood, it may inflict death. If the dasa coincides with later part of life the person will enjoy great Rajayoga. There will be however lack of physical comforts ## Page 314 "310 Saravali emargaad qafad zea MTT | aafagert gaa fereaefattiera: go: cae uRKU mace wary camaged a fracigad ai FAIRSTR vifereee: et wars Fea Ra qemget fag area ated wh Bea aN vase, ged, Bearaft APE neon sta aye) quet (argfigaett aaaqeq o) agrees freanypefadthadtsat: ga: wasn Fares. Faas: | eager te Bea * mart aren fan ‘eatgatctiond arfr mR nt atefaara. qe fra. aamaafegia < emapattante seater” afta: ea ATT: RON 25:30. MARS IN’ OWN RASI AND IN’ ASPECT TO OTHERS :“ Should Mars’at birth be in Aries/Scorpio and'be aspected by the Sun, the person will possess wealth, wife atid children, be a king's minister; be’a' justice, be famous and be'a charitable king. If the aspect is by the Moon, the native will be ~ bereft of mother, will have’a wounded body, will hate his‘own people, will not have friends, be jealous and will have feniale children. If Mercury aspects the saidMars, the subject will’ be an expert in stealing others’ money, be a liar, be devoted ‘to Manmatha (i.e. highly libidinous), be hostile and will frequently visit prostitutes. If Jupiter’ lends ‘his aspeet to Mars as above, the native will be learned, sweet-spoken;” fortunate, ‘dear to parents, be very affluent, and will be aking par excellence. Venus aspecting Mars as above denotes that the native will be imprisoned due to females, and will be deprived of his money on account of females, more than once. If Saturn aspects Mars as mentioned above, the native will be capable of hindering thieves in spite of his being not valorous, will be devoid of iis men and will maintain another woman, ## Page 315 Chapter 25 3b Notes: When Mars occupies his own sign in aspect to, friendly Sun, the person will enjoy all kinds of wealth. (For Aries, Leo Cancer and Scorpio, Mars related to the Moon, the Sun or’ Jupiter is generally beneficial.) Mercury aspecting Mars in Aries/Scorpio will give him all bad qualites and make him go after other women. When Venus aspeots Mars in Aries/ Scorpio, the person is prone to risk through females. Saturn aspecting is congenial for becoming a police officer aad the like while it contributes to illegal relationship with females. aaqaag wa crarfect wagagfaqe: 1 faae cfr get saveaa: gh ate: ue aigzteat fant agqadtai ofa: freeatara gr oufept |= canitasiad aR wagiert ageat | Ageia Aaya * feat waft a WR geet meafeger an atfaattafafaa: atanaqa: raarqafaaa i ganar fafaad et gear wag cela: uaeu qaqa avefaa: farara: sfagarat at arye wafe gh gaa fading afea: nau aay eal aaaTy facade: FH faarq afagearrermtag: feat a afaast uaeu 31-36. MARS IN A HOUSE OF VENUS AND ASPECTED BY OTHERS : If Mars is in Taurus/Libra, with the aspect of the Sun, the person will seek to move in forests and hills, will hate women, will have many enemies, will have fierce appear- ance and be courageous. If Mars as above is aspected by the Moon, the native will not honour his mother, be wicked, will lord many women and be dear to them and will fear war. If Mercury aspects the said Mars, the native will promote quarrels, will speak much, will have a soft body, will possess (indifferent or) few sons and little wealth and will be learned ## Page 316 312 Saravali in Sastras. If Jupiter aspects Mars as above, the subject will be skilful in music and in play of musical justruments, be fortu- nate, be dear to his relatives, and will be pure. Jf Venus himself aspect Mars in the above condition, the person will bea king’s minister, be liked by the king, be an army chief, will have famous name (i.e. titles etc.) and will be happy. Saturn aspecting Mars as above indicates that the native will be happy, famous, wealthy, be endowed with friends and own men, be learned, and will be head of a group of villages/towns, or group of men. Notes : The aspect of the Sun on Mars in Libra/Taurus makes the native living in lonely places or remaining aloof from others. He may not have good relationship with his spouse and other women in general and is prone to litigations. If the Moo be the planetaspecting Marsas above, the person will have rela. tionship with many women, will contract diseases of the blood- private parts etc. Mercury's aspect on Mars thus posited will promote learning, and belligerent tendency but the native will have either few sons or will have indifferent ones. If Jupiter aspects Mars as above, the person will be wealthy, will have untarnished image and will be generally skiful Venus aspecting Marsin the former's Rasi the native will enjoy high position in life, particularly in fields like army, and become widely famous Saturn’s aspect on Mars so posited is favourable for wealth, position, relatives etc. particularly if the ascending sign belongs to Saturn or Venus. faareaatigd = fafeaagifed = grace gavat caryt saaft gz: var cfu uz afed afta ard weargeeae gafraraqag | aq oaagenst oaaafa | aati whe usu faftrivamreagad aguifraraageard 71 a aggead saafe ast gift aaf uaen waged sari atta fata at Het aafearg gut gael aay a yee: won ## Page 317 Chapter 25 313 qeu gaa: elgant sagaad 7) Gara | TTR: HM | ACATATRTTT een meciigizd owieaftgenitG = Feit afeqeafa a afad aaferat gage fawagtay eqn 37-42. MARS IN MERCURY’S RASI AND IN ASPECT TO OTHERS: If at birth Mars be in Gemini/Virgo and in aspect to the Sun, the native will be blessed with learning, wealth and courage, be fond of hills, forests and fortresses, and be highly strong. If the Moon lends aspect to Mars as above, the person will be happy, wealthy, splendorous, will guard women’s apartments, will be endowed with women and will manage the king’s residence. If Mercury aspects Mars as above, one will be skilful in the art of writing, in mathematics and in poetry, be garrulous, be liar, be a sweet speaker, be a messenger (or an ambassador), and will endure lot of misery. Should Jupiter aspect Mars in Taurus/Libra, the native will be a king’s representative, be bright, will go to foreign count- ries as an ambassdor, be skilfull in all doings and be a leader. If Veaus aspects Mars in above position, the person will do the jobs of famales, be very fortunate and will enjoy food and robes. If Saturn aspects Mars as above, the person will be interested in wandering in mines (i.e. places beneath surface), hills and forests will have husbandry as his {livelihood, be highly miserable, be very valorous, dirty and be devoid of wealth. 7 Notes: If Mars is in a Rasi of Mercury, i. eithe Gemini or in Virgo, and aspected by the Sun, the native wi enjoy a high degree of education, particuarly in the field of law, chemistry etc. The aspect of the Moon on such Mars is favoura- ble for positions like security officers, house governors etc. If the planets involved are with strength the positions will be superior and if weak the state relates to ordinary watchmen and the like. The aspect of Mercury can give positions like ambassador and the person can prove himself a famous writer, poet or mathematician. Pursuing astrology is also worth with ## Page 318 314 Saravals this position. Jupiter aspecting Mars thus posited is again favourable to be an ambassador or to hold senior positions in Embassies. Should Venus aspect Mars in Gemini/Virgo, one will carry out the orders of females. If the planets involed are auspicious the person will have a smooth married life. Saturn’s aspect on Mars may denote miners and the like and agri- culturists. This combination adds to miseries and misfortunes. freenizatgedaedt ausaraat dt cemayger WA feaweqed. Wagee: wean aghratfatradt terart faeatgra afarcrait | qat afareriged arate sen afer: ararare: aqzggral algoge: eat wee gage fiafrana wafer. factor: ew feenat qr fagiermfadt wag: get afirrat: dhtea feast aw equ: eiagigama: faa: eitgdeat ates), weet fiefegt feast 9 earigareaa: ween’ werdarareert: farfaarret: garg afer: 1. atfnggede® wthaafe carq war ara: ecu 43-48, MARS IN CANCER IN ASPECT TO OTHERS : If Mars be in Cancer at birth and is aspected by the Sun, the -Rative will be subjected to bilious diseases, be splendorous, be a justice in position and,be valorous, If the Moon aspects Mars in Cancer, the person will be troubled by various diseases, will have mean conduct, will possess. an unsightly body and be miserable. Meroury aspects Mars in Cancer,, the person will be,dirty, sinful, will possess a mean family, ‘will be rejected _ by his own men and be shameless, If Mars in Cancer is aspec- ted by Jupiter, the native will be famous, be king’s minister, be learned, charitable, wealthy and be bereft of carnal plea- jamres, If Venus aspects Mars. in Cancer, the subject will be ## Page 319 ‘Chapter 25 x aang grieved on account of woman’s company, be insulted by women and will’ lose wealth on account of women. Should Saturn aspect Mars in Cancer, the native will aquire -money” through journey in water, be equal to a king, be sportive * in = —_ and be always bright. 1» ma Notes : If Mars is in Cancer and is in aspect to Jui iter, Moon or the Sun it constitutes Neechabhanga, which wi _ Sequently give rise to acquiring Position and money. The ag} _ of Moon or Sun on Mars in Cancer will produce many diseases while that of Jupiter makes one averse to sexual pleasures, or may give less opportunities in this direction, Should Venus aspect Mars in Cancer, it is not congenial for a happy matried life-and will be a cause of misunderstandings with females. The aspect of Mercury on Mars in Cancer causes stormy-weather in family life while that of Saturn indicates position ofa on gre) driver, ship captain’etc. and gives wealth: - 13 sara feaantt faa: caira dqarays: 1 . mgraariraret fae wt arefergee wen’: agi gut aftarg aioamdtet fagaatio: |) Raferat wR afar | getsqrained: Weetee -agfreait Gea: mremmaterel faamaita qamat aA gaat geesfafagara magn wefrastcadt fanart feggia wafga Faget yet ee ARTA: UNn fafaretteitnga: eitquat freitadt gee: 1 | Rage ‘carg? fade get was: than gare fea: Teteraraattaara gett feracerst efat feawcetda age evn 49-54, MARS IN LEO IN ASPECT TO OTHERS: If Mars is in Leo at the time of one’s birth, and aspected by the Sun, the native will be humble, helpful to friends, be endowed with'own mea, and be fond of wandering ’in cow-houses, forests ## Page 320 316 Saravalt and hills. If the Moon aspects Mars in such a position, the native will be ominous for his mother, be intelligent, will possess a hard body, be widely famous and will obtain money through women. If Mercury aspects Mars in Leo, the native will be clever in many arts, be a miser, be skilful in poetry and fine arts and be wicked. If Jupiter aspects Maré in Leo, the person will be close to the king, be highly learned, be of pure mentality and bean army chief. Should Venus aspect Mars in Leo, the person will have union with many women, be fortunate in respect of his wife and will be ever juvenile, Saturn aspecting Mars in Leo denotes that the person will look like an old man, be poor, will wander in others” houses/be miserable. Notes : Mars in the Rasi of the Sun if aspected by the Sun himself will confer abundant wealth, But this combination will show some affliction to heart. If the Moon aspects Mars in Leo, he will pose danger to mother particularly for Taurus and Aquarius ascendants. When Mercury aspects Mars so placed, one will become proficient in writing. Jupiter’s aspect on Mars in Leo is a favourable augury in the matter of finance and posl- tion, but the native will be fiery in temperament. The diseases that may occur to him may be easy to diagnose while cure may not be fast. The aspect of Venus on Mars in Leo will help the persoa maintain his youth in tact while he may go after many women Saturn aspecting Mars in Leo is generally very bad but if the Lagaa be one of Aquarius, Capricorn or Libra, this relationship becomes very favourable and the native will have abundant wealth and be happy. If it is mutual aspect, even Ares and Scorpio natives will stand to benefit. ateared gai aafifegig aearqgaray | geared vite: acti claoifina: meq nut fawet woygsrad sist fire: etfs frase: 1 fagid geaat acfafarg mar gerq ue Rearfat gfage faeqrard gaa dese: 1 geaaa fafaara: sdf faeiaraaq nxn ## Page 321 Chapter 25 317 avaa gavlgd fegfaeqed a fanaed a qevaa gaqel smart FH: FTW ys gadtarafaaiad faaragreaifragarey | fanageafa a gua gow pretfaa: Ha: GIA U YEU qetsam afagse: Halegareaga ot | aed gaara owitd FH: HN gon 55-60. MARS IN JUPITER'S HOUSE IN ASPECT TO OTHERS: If Mars occupies Sagittarius or Pisces at birth and is aspected by the Sun, the subject will be world~ honoured, be fortunate, will live in forests, hills and fortresses, and be cruel. If the Moon aspects Mars as above, the person will be deformed, belligerent, learned and be always inimical to the king. If Mercury should aspect Mars in above position, the person will be a scholar, be skilful, learned in fine arts and be highly learned in general. If Jupiter aspetcs Mars as above, the person will be devoid of wife and happiness, will be beyond the reach of enemies, be wealthy and be fond of exercises. Should Venus aspect Mars as above, the person will be very much dear to women, be interested in cosmetics, makeup etc., be charitable, be libidinous and be fortunate. If Saturn aspects Mars as above, the person will have defective body, be sinful, wandering-natured, devoid of happiness, and interested in others’ religion. Notes : Should Mars be in Pisces or Sagittarius and be in aspect to the Sun, it brings honour from the world. Recogni- tions like Nobel Prize winning etc. may follow. The position to be held by the native will have a world-wide bearing even if favourable planets like the Sun, Jupiter or Moon be in a Kendra position to Mars in Pisces or Sagittarius and will make one achieve world-level distinction. (This equally applies to Mars in Leo angular Jupiter, Moon or the Sun). Kalyana Varma attributes evil results to the Moon’s aspect on Mars ina Jubiterian Rasi except that the native will be learned. Though the Moon and Mars are friendly and the position of Mars is ina friendly Rasi, the author’s observation deserves significant note. This relationship causes some deformity of limb. If the ## Page 322 ase ° *Saravali) aspects are; potential, it, maybe right from. birth -and if be meagre there are. chances of proneness to deformity, in some form or other at a later stage in life. Saturn’s aspect on Mars in Sagittarius or Pisces also indicates some physical deformity, lack of.happiness and attachment to other religions than his own. The crs of Venus is fortunate. anise at abfiraneateifreatiee 1 yo Balestier dere afr: | weA ee : aqeaige seer aaisagreniftagaiey | _ afearaigenten aadfa aed firat am: 0 ea. afangermanad cfaarang 7 fag aracay | , TNE Sarat gueitfinat aH ga Cafeed arang aafagranfad feaereraq C detga. amat qeeese: wit wrearaq vex nu ‘fafadiadtnned afa® eittieaigeta | gu, gear saafe, waafret am gu aafrafafanad gafaged agasi sags 4 _ gariga waited walla fat aeitferad vita: ng, 61-66. MARS IN SATURN’S HOUSE AND ASPECTED ° BY‘OTHERS : Should Mars be in Capricorn or ‘Aquarius: and be.aspected by:the Sun, the subject will have very dark body, i be::courageous, will have many wives; sons and abundant wealthand.be very sharp. If the Moon aspects Mars’ as above, onetwill’ be:fickleminded, be not well disposed towards his: mother, befond of beatification, be charitable, benot firm friend/ship; and; be rich. If Mercury aspects'Mars in'Capricorn.- on:Aquarius, the’ subject will .walk ‘very slowly, be not-tich, will mot: bavevany profession, be not strong, be not outspoken, and:be:niot!virtuous.” If Jupiter ‘lends his aspect ‘to’ Mars-.as\. abovesithénative::will be: very beautiful,: will "possess: kinigly: qualities) owilbvfulfil his undertakings, be long-lived:.and be endowed with: relatives. :.If Venus aspect.Mars as. above one: ## Page 323 Chapter 25 319° will be endowed with various kinds of (carnal) pleasures, be ‘ interested in fostering women and be belligerent. Should Saturn » aspect Mars, the latter being in the former’s house, the person will be a king, be very affluent, will hate women, will possess * many children, be ledtned. be devoid, of happiness and be timid in war. » Notes: If Mars.is.in Aquarius or Capricorn and is aspected by the Sun, there will be plurality of wives,many . male issues and great wealth. If Mars is exalted in the ascen- dant while the Sun is in Cancer, more than one marriage is inevitable but when Aquarius rises with Mars, the Sun being in Leo as the 7th lord, it will only end with. one marriage. Mars in a Rasi of Saturn in aspect to the Moon will have an adverse. beating on mother’s longevity. Mercury’s aspect is unfavourable _ for money and profession. Should Mars in Capricorn or Aqua- rius be aspected by Mars, the native will enjoy pleasures of bed with many a woman and will be devoid of moral conduct. Saturn’s aspect on Mars thus placed is auspicious for money and position while the native will not be happy in many fronts in life. He cannot maintain good relationship on family’ level. shtipenrarsdfaetarat arcaeat tard are qoafeeoora: IMI '-* Thus-ends the 25th chapter entitled “Effects of Mars in « Various Rasis” in Sarayali of Kalyana Varma. ft t : ’ a ay FIARTEATT REM

ay -~ Various Rasis © ‘*, fatengea aararat feeqdtesaars: | vaMiaqafaral a aaaaat vata fatafag we we _ Bear ware agarierameeaa: y~ * ° vy WUE aut aafeaz:, ratg find. git fea: nan o/s Qe MERCURYIN ARIES : If Mercury is “in: Avies-a thectime of one’s birth, the native wilbbe! fond ofcbattles: (bg - ## Page 324 320 Saravali uncompromising), be very learned, wicked, emaciated, interested in music and dance, be untruthful, be attached to sexual pleasures, be a writer, will produce fictitious things, will eat much, will lose hard-earned money, will incur debts and imprisonment frequently and will be sometimes fickleminded and yet sometimes firm in disposition. Notes : The placement of Mercury in Aries will give a tendency of stubbornness and uncompromising nature. Even at the slightest thought of sexual pleasure, the native will get deeply merged in it and will be after women. He will face frequent loss in transactions and accumulate debts, will be a good eater and a good writer as well. He will be both firm and infirm ni disposition. If there are other combinations warranting imprisonment, Mercury’s position in Aries will strengthen those. The native will be more a loser with Mercury in Aries. (His occupation of Scorpio will also give rise to similar unfavourable results, vide sloka 15-16 infra-) Now a glance at the results of Mercury’ position in Aries while diffrent Rasis become ascendant : Aries ascendant : The native will lose his mother or father early or may live away from parents. Childhood will see frequent trouble while the later period may be prosperous if other favourables positions emanate in the radix. The native may be piously disposed. Taurus ascendant : He will not have many children, will not gain but be interested in religious activities. Gemini ascendant : He will earn abundant money but is susceptible to serious losses. He will be the eldest issue of the family which is more certain if aspected by Jupiter or Mars. Cancer ascendant : The dasa of Mercury will prove fully beneficial. Leo ascendant: There will be yogabhanga (obstruc- tion of prosperity of the native) in Mercury dasa and loss of paternal and self-made wealth in the hands of enemies and in litigations. Virgo ascendant : He will be short-lived, will face obstacles in all his undertakings and will exhaust all ancestral properties. Libra ascendant : The spouse will not be loyal to the native. The native will himself be a profligate. Scorpio ascendant : The native will prove a proficient writer, will have a long lease of life, will enjoy Rajayoga in Mercury dasa, and ## Page 325 Chapter 26 321 will earn land, wealth and others’ properties. Sagiitarius ascendant : He will enjoy maternal happiness, conveyances lands and learning. Father’s death may be early if the Sun is not strong enough. Aquarius ascendant : He will be exceptio- nally timid, will fear speaking before public, will not main- tain good relationship with his elders and will have many sisters born after him. Pisces ascendant : He will improve his monetary position after marriage. If however Jupiter is in Libra, all earnings will be lost and he will become abrubtly bankrupt. wa: saswarat earat fawraaeorenra: 1 wararacqaaarearara: = feaaafa: gu eataereiatga: fraaeyed ygtarara aredgreaman vate ¢ gt aay 3-4. MERCURY IN TAURUS : Should Mercury be in Taurus, the native will be skilful, eminently liberal, be famous, will have knowledg* of Vedas and sastras, be fond of exercises, robes, ornaments and garlands, be ficm in disposition, will have sincerely earned wealth, will possess a chaste wife, will bea soft and sweet speaker, and be after sexual satisfaction. Notes :In Taurus, this planet proves very favourable in many respects, in general while adversities will depend on the ascendant and the planets aspecting. Generally speaking, the native will be skilful in the matter of association with females for carnal pleasures. The various ascendants with Mer- cury in Taurus are able to produce the following general effects: Aries ascendant : One will suffer from some eye disease or the other. (With Saturn and Mercury in Taurus it may pro- mote dental deficiencies). He will gain through cousins and brow thers. Savings may not be much; will earn more and spend more. Taurus ascendant. He will be beautifu', healthy, spiri- tual, learned and modest. His progenic ability will not be at stake though Mercury is impotent by nature. On the other hand, he will beget many issues. Gemini ascendant : This position of Mercury in Taurus does not confer beneficial results ## Page 326 322 Saravali in its dasa but the native will be liberal and will do only good acts. Cancer ascendant: He will earn in fair ways but will sometimes incur losses. Leo ascendant: Spiritual teachers, astrologers, vedic exponents, secretarial assistants etc. will do well to have Mercury in the 10th in Taurus. The native will cain abundant fame, money etc. Virgo ascendant : He will be a source of luck to the family. His father will particularly prosper. Libra ascendant : This position denotes an ill-placed or ill-disposed father. The native will suffer absolute penury and misfortune and be sadistic. He may be shortlived. Scorpio ascendant : The native will enjoy premarital sexual relationship with many women. His marriage may consummate only with great difficulty. His elder brothers may be a source of disappointment. Sagittarius ascendant: He will not enjoy a position with powers. His wife will be sickly. Capricorn ascendant : He will have loss of children or those will be subject to frequent onslaught of diseases. Aquarius ascendant : His mother will be of questionable character unless Mercury is well-aspected. His learning will be hindered. Pisces ascendant: He will not be happy with brothers and sisters. He may have a step-mother. gua: frond) semaaal facet art: Miraaganserfalzeigedt faareta: nyu afracrnatiata: ef: caaea: fro: saraza: 1 adoaggafey =o aefagaed «ga wafa nen 5-6. MERCURY IN GEMINI: If Mercury occupy Gemini at birth, the subject will have an auspicious apearance, will speak sweetly, be very affluent, be an able speaker, be honou- rable, will give up his happiness, will cohabit less, will have two wives, be fond of arguments, will be learned in Vedas, Sastras etc. be a poet, be independent, dear, very munificent, proficient in work and will have many sons and friends. ‘Notes : Mercury in Gemini gives a beautiful appearance. (This is more true if the sign in question ascends.) He will have more than one marriage. He may sometimes lack happi- ness but be highly intelligent. The following are the general ## Page 327 Chapter 26 323 effects when Mercury is in Gemini in relation to the 12 ascend- ing signs = Aries ascendant : The native will have more female co- borns than male. He will be highly intelligent and will have a sickly father. Taurus ascendant : He will earn plentily and save. If Jupiter from Sagittarius, is opposed to Mercury there is a risk of one’s becoming poor. If malefics join Mercury in Gemini, it may be fatal. Gemini ascendant : If Mercury is alone in the ascendant, he proves very auspicious. The native will have healthy body, wealthy family, be highly intelligent, obstinate and pleasant in disposition. (According to Bhrigu Sutras, Mercury in Gemini or in Virgo ascendant gives happiness from brothers and attainment of heavens after death.) Cancer ascendant : The native will have nothing left out of his earnings, and will be free from diseases. Leo ascendant: He will be ever happy and will earn by fair means. He will have more daughters. His children will become very famous. Virgo ascendant : One will have significant position in life, be modest and be of good conduct. For sucha native association with predictive sciences can lead to prosperity. He will pursue earnings in many a way. Libra ascendant : One will have an unfortunate father who will flourish later on. Scorpio ascendant : He will enjoy along lease of life. If Saturn joins, it will be greater. Mercury alone in the 8th in Gemini may cause obstacles in educational pursuits, open to betterment in years to come. Sagittarius ascendant : One will obtain a chaste wife but a few children. His Mercury period will confer significant prospeirty, Professionally he will be happy. Capricorn ascendant : This placement of Mercury has a mixture of both good and adverse fortunes. Sometimes it produces irreligious persons without code of conduct. Aquarius ascendant : He will have intelligent progeny and more female offspring. If Mercury receives unfavourable aspects from the nodes, Mars or Jupiter, Iunacy may result. For this yoga, the strength and disposition of the Moon must be reckoned. Pisces ascendant : The 4th house indications will generally prosper. If Saturn aspects Mercury in Gemini, the native’s wife may not get on well with the father of the native. ## Page 328 324 Saravali iat fatafaca: vitefatarfeanfansa aaait agsraray camry fagaataza: Not eMaceazer: geet agfaarfara: 1 gafa: waedet cadatat sfageanc 7-8. MERCURY IN CANCER: One born with Mercury in Cancer will be learned, will be fond of living in other count- ries, be interested in cohabiting with women and also in music, be fickleminded, prattling, inimical to his own relatives, will be fond of arguments, will lose wealth on account of einmity with women, be of bad disposition, be interested in many jobs, be a good poet and will be popular on account of the fame of his ancestors. Notes: When Mercury is in Cancer, the person’s liveli- hood may be in places other than his birth place. The native will be fond of entertainments. He will not be in good terms with his relatives. He will take pleasure in liaising with courtezans and will spend heavily on this vice. (If Cancer happens to be the 6th house with Mercury therein, i. e. Aquarius ascending, he will bea first-rate drunkard.) He takes birth ina faimly which is already popular and famous. The native’s personal disposition depends greatly on the Moon in particular, and on other related planets in general. What the 12 different ascendants are capable of giving with Mercury fixed in Cancer, can be estimated from the following account. Aries ascendant: The child causes great pains to its mother at the time of delivery and possible sickness or debility to her prenatally Normally he residens ina place adjacent to water. He will have abundant feril lands with some IItigations on accouat of them. Such natives are more unexceptional to have cardlac afflictions. Should the Sun join Mercury in Cancer, this calamity is more sure to follow. Taurus ascendant: Mercury in his dasa may sustain the prosperity given by Saturn dasa. The native’s coborn may gain fom him whereas he will stand to lose on their account. Cancer ascendant; An undesirable position indeed for gocd health, for it can cause mental instability and nervous breakdown. Even dreaded ## Page 329 Chapter 26 325 discases like paralysis will take birth in the life of the native, if Saturn is related to such Mercury. Leo asecndant: If Mercury is not alone but with two favourable planets in the 12th, the person will amass weath. Otherwise, there will be expenses in astronomical proportions. Virgo ascendant: He will gain through water and water-born products. He will either be the eldest issue of the family or will be residing with hls elder brother in sister for a long period life. Libra ascendant : If Mars joins Mercury in Cancer in the 10th for Libra ascen- dant, te native’s father will have fear or danger from water. Mercury alone in Cancer will denote serious trouble for mother’s longevity. Scorpio ascendant: The native will not receive any help from his father. Alternatively the father may be short-lived. Sagittarius ascendant: There is a lot in want in married life and public relations. Frequent changes in livelihood are denoted by this position. Capricorn ascen- dant : The married life is a liltle better with Mercury in Cancer for Capricorn ascendant as compared to Sagittarius counterpart. There will be unfruitful wanderings in Mercury’s major period. Aquarius asdendant: Frequent expenditure on health of children and misfortunes to the subject are denoted. Pisces aseendant : He will get beneficial results in Mercury dasa. Generally, one will worship a female deity and obtain her blessings. aiamaraftetat ctweqrat «6 aacaareara t werenfasa amar arafegia: agagaruen ealgaa: caeeay weramAt ga wafs gaa: Seisaeg fag canafaedt qarfetrsa u gon 9-10. MERCURY IN LEO ; Should the planet Mercury occupy Leo at one’s birth, the native will not possess even bit of wisdom (ar is a bit and hence arq¥at is interpreted thus), be famous in the world. be not truthful, will possess a weak memory, be wealthy, be not strong, will indulge in fratricide, be unfortunate in respect of wife, be independent, mean in conduct, be a servant, be devoid of children, be against his own race but be favourable to others. ## Page 330 326 Saravali Notes : Gnana kala pariheeno has been interpreted by some commentators that the native will lack wisdom and will be devoid of association*With.arts, However, according to Kalyena Varma, the native with Mercury in Leo may lack wisdom. Even Varaha Mihira in his Brihat Jataka (ch. 18, sloka 10) uses the word ag denoting absense of wisdom, Gunakara of Horamakaranda (1496 A.D.) too uses the same word in this context. This position of Mercury, however, should be favourable for world-wide fame. The native will be unhelpful to his co- born, whether he literally kills them or not. Childern and marri- age may not give him happiness. Sometimes, there isa chance of the native not obtatning progeny at all with Mercury in Leo. His memory cannot also be of much help to him in times of requirement. In individual cases of different ascendants, Mercury in Leo produces tie undermentioned effects : Aries ascendant : This is an ascendant which lack abso- lute wisdom with Mercury in the Sth in Leo. The subject will not have happy progeny. Taurus ascendant : This position may prove a maraka for the mother. More so in Mercury’s major period. Without meaning any disrespect to the original text, we may say that the person will be intelligent and wise, for the staement originally made and rendered is only a genera- lisation, Gemini ascendant : Dryness of throat, its burning sensation, gruff/shivering voice, trembling bands etc. are some results to be considered on adverse side. There are advantages with this position of Mercury too-a fortunate parent, resources through forests etc. and lands, though uncultivable, *VIrgo asce ndant : There will be a tendency to seek sexual gratificaiions, in unnatural ways, joblessness for a greater pert in life, emacia- ted body and poverty. If Mars joins Mercury in the 12th, blood transfusions may be occasionally required. by the Moon, the need does not arise as above. Libra ascendant : Mercury in the 1Ith in a dry sign as lord of the 12th and 9th may make money some what scarce, The fortunes of the native are also susceptib- Je to break downs. Should Venus join with strength, then the ## Page 331 Chapter 26 327 Position gets quick relicf. Scorpio ascendant : Though one may call it ‘Amala Yoga’ with Mercry in the 10th it does not prove useful to the native; on the other hand it generates some worry or the other. This baneful planet for the ascendant in question Posited in Leo forebodes definite early evil to mother. She may not have any more living children following the native under consideration. Sagittarius ascendant: This position suggests tastelessness in married life and absence of progenic ability in the wife. Ifhowever she has strong disposition of Sth lord/ Jupiter and the like, this defect is greatly modified. Capricorn ascendant : The subject’s eye sight will develop defects fat avery young age. Misfortunes in his life will not be uncommon. Aquarius ascendant: Though the wife may be of good disposition, she is bound to be barren or sickly. His children will, if obtained, be not very intelligent. Pisces ascendant : Married life may be long-lasting. with public relations unfruitful and strained. Inflow of money and its outflow seem to have equilibrium. eafiatsiraredt «= age: | eqreserareda: | faarafrecfacaY «age: «= eteacaetdza nee vies: qua: qgat met faadtaarcaraca:t eat gaeare: weaat Ma amATT UV 11-12, MERCURY IN VIRGO : If Mercury occupies his exaltation sign (Virgo) at the time of one’s birth, the native will be quite virtuous, eloquent, skilful, will have knowledge of writing (i. e. be an exponent) and poetry, be learned in fine/ mechanical arts, be sweet in disposition, be liked by women, be not much virile, be the eldest son of family, be honoured by virtuous, be disposed to serve others, modest, argument- ative, famous, charitable and strong. Notes : Mercury’s exaltation detracts the virility of the person, according to the original text. Obviously because this planet rules impotence in a person andits strength gives tise to more impotence. The Sth lord’s position and Jupiter also stand for consideration. Remaining in Virgo, Mercury will produce following results for the 12 different ascendants : ## Page 332 328 Saravali Aries ascendant : While an authority says that Mercury in the 6th in Virgo promotes debts, enemies and diseases fully, meseems this position combats these adversities. (We cannot say that these defects will be completely offset. To some extent one has to suffer these debacles with Mercury in Virgo in the 6th.) Tavrus ascendant : Should Mercury be in the Sth in Virgo, the subject enjoys excellent Rajayoga with wealth, conveyances and high position. His children may reech good status in their lives Gemini ascendant: Even if the Sun severely combusts Mercury in the 4th in Virgo, according to Jataka Parijata the person receives abundant education. He may professionally prosper Cancer ascendant : His co-born will be instrumental for his good fortunes. Mercury dasa will give only mixed results. Leo ascendant: When Mercury occupies the 2nd in exaltation, the person will be an expert speaker, will have appealing face, will gain huge sums and will live long He will also obtain hidden wealth and te successful in competitions etc. Virgo ascendant : The native will earn abundant fame, learning and wealth. He will attain heights in life in Mercury dasa. Professionally he will remain well- placed throughout, Libra ascendant : He will spend his money on charity, religious acts etc. Mercury does not make much contribution to the native’s prosperity when occupying the 12th in exaltation. Scorpio ascendant : The native will enjoy a long span of life and will earn wealth uninterruptedly. However, he is not free from troubles of general nature. Sagittarius ascendant : He will obtain a spouse of a supreme class possessing all virtues, and will enjoy great position in life. It is possible that there will be frequent debacles in earnings. His spouse can look forward to exellent under- standing with her mother-in-law. Capricorn ascendant : The native will be a synonym of fortune. Particularly his Mercury dasa willtake him to enviable heights. Aquarius ascendant : Mercury will only give an oridinary yoga. Generally, such natives acquire more female children. Lives to them will be more miserable than happy with Mercury in exaltation in Virgo in the 8th. The life is of course for a long span, Pisces ascendant : Marriage will prove a beneficial contract. The latter part of Mercusy dasa may inflct death. ## Page 333 Chapter 26 329 freafaararfre arragdtsalaeiftaaeaazg | atarfeqteacfa-fasifafatagenaa: ween samqaiera: = «ogardt = fararaa! awanvay ofa seraafiasatagizata: u gv 13-14. MERCURY IN LIBRA = If Mercury falls in Libra at the time of one’s birth the native will possess know- ledge of arts, be intent upon arguments, be an able speaker, will spend money lavishly, will have business in various directions, will honour wisemen, guests, gods and preceptors (elders), be skilful in pretending to serve others, be amiable, devoted to gods, fraudulent, fickle-minded and sometimes short-tempered and yet sometimes (notably) peaceful. Notes: Remaining in Libra, “Mercury will produce following different effects according to different Lagnas. Aries ascendant : Mercury in the 7th in Libra may give a brilliant, educated and beautiful spouse, who will also be cunning, unadjustable, sickly and lavish. Sometimes in the Post-marital life, the native himself may be subjected to diseases. There is also a possibility of unhappy marriage if the Sun is simultaneously in deep fall, joining Mercury. It has been observed in our experience that the Sun/Mercury yoga in the 7th gives an Aries native marriage out of his religion and even country. Taurus ascendant: Mercury in Libra gives worries on account of monetary problems and of children. The person may develop speech problems in the initial part of life but may become all right latter on if Jupiter is favourably placed in angle/trine. If Jupiter is not so posited while Ketu/Rahu join Mercury in the 6th, the defect is perennial. Ifthe Ashtaka Varga bindus are not favourable in the 2nd/6th, this is all the more certain. Gemini ascendant : There may be numerous female children. The native will beget all comforts in life. Cancer ascendant : The native will receive high education, inspite of the fact that Mercury rules the 3rd and 12th. Leo ascendant : The native will enjoy fortunes through his sisters. His financial status will gradually improve ## Page 334 330 a Saravait throughout. During Mercury dasa there will be abundant prosperity. Virgo ascendant : There will be danger to life during boyhood, particularly for one starting with Mercury dasa. Monetarily, there will be overall satisfaction. The native proves an able speaker and earns money through his speeches etc. Libra ascendant: Birth may not be in good circumstances of the family. It is however profitable and fortunate in the middle of life. High expenditure, misfortunes to father through the native or vice versa and death in own village will result, Scorpio ascendant : This confers a long span of life while boyhood will be full of hurdles. Life will not be a bed of roses but will have a thorny path ahead with Mercury in 12th in Libra, Sagittarius ascendant: Plenty of money through ancestors and through marriage will result most of which will however be at stake. Many obstacles will have to be faced in profession and money matters. Death or trouble to an elder brother/sister may follow the native’s birth. Capricorn ascendant : Very fortunate circumstances will prevail in professional sphere. They are more successful businessmen than any others. If Saturn joins Mercury effectively, one may become notable among medical men. Aquarius ascendant: Mercury in Libra willgive mixed results about one’s fortune and general among prosperity. The native’s birth may portend evil to father. Pisces ascendant : The subject may seek physical relationship with many women, Married life may not be satisfactory, only tending to separation. Intelligent co-born, problems relating to throat/lungs end sadistic disposition will result, One may be harsh in speech. STAAGTATTT: AGTMRIMAAATATS | get oF oargaitet geal geermareaay: 1 gk areuasfragrafeetemig — freg: mariage: AVALEAIATAATT HIE UL EEU 15-16. MERCURY IN SCORPIO : If Mercury is posited in Scorpio, one will experience troubles, grief and evils, will hate the virtuous, will be devoid of truth, religion and shame, bea dunce, be not virtuous, be a miser, will ## Page 335 Chapter 26 331 cohabit with wicked women, be fond of giving cruel punish- ments, be not out spoken, be interested in blameworthy jobs, will incur debts, will join base men, and will steel other’s properties. Notes : For various ascendants, Mercury in Scorpio will give different results as below : Aries ascendant : The subject will develop many vices and fall in bad people's company during adolescence. One will aquire an extravagant spouse. The life span willbe long. Taurus ascendant : There may be wide difference of opinion with the near and dear. Even the spouse may be short-lived. Mercury dasa will give extraordinarily benefic results; more so if Venus joins Mercury in Scorpio. Gemini ascendant: This is not a good position for mother’s longevity. The native will bimself be unfortunate in more than one way. Cancer ascendant : The subject will enjoy abundant riches, conveyances, and learning and supreme position. One of the parents will be seriously afllicted with the birth of the native, Virgo ascendant : ‘The native’s father will prosper sigaificantly. Paternal earnings will be likely sacrificed to co-born. Libra ascendant : Dental diseases, sight defects and short life may result out of Mercury's position in Scorpio in the 2nd. Scorpio ascendant : The native’s boyhood will not instil hopes of a fair longvity. He will be sickly throughout and will suffer from many diseases and from some kind of physical deformity. If Ketu joins in the ascendant, there is a possibility of lameness and unobstruc- ted thievish disposition. Sagittarius ascendant : A ruffian is born with Mercury in the 12th in Scorpio, Regardlessness for marital bonds will be more pronounced in such a native. Early death of mother is denoted by this position, Capricorn ascendant : There will be huge gains. Earnings will be made very tactfully. Aquarius ascendant : There will be ups and downs in profession but the subject will on the whole highly prosper, The initial half of Mercury dasa will bestow very beneficial results. Pisces ascendant: The native will aquire many landed properties. ## Page 336 332 Saravali faematagu: seagfastdsitaaarfana: t mat gifedt ar sasearet aarfaaa: eon ameqrqafarat Rardt arecga’at ara fafafacrmitgae: mrimdee gk oan tcl 17-18. MERCURY IN SAGITTARIUS: Should Mercury be an Sagittarius, thc native will be famous, liberal, will have knowledge of Vedas and Sastras, be valorous, will practise abstract meditation, be a minister, or a family priest, be chief among his race-men, will be very rich, be interested in performing yagnas and teaching (Vedas etc.), be a skilful speaker, be charitable. and be an expert in writing and fine arts. Notes : Mercury in Sagittarius will produce following various effects for various ascendants : Aries ascendant: There will be success over and gains through enemies, litigations, cousins etc. The native may be inimical to his father. Taurus ascendant: Frequent diseases and heavy expenditure will result. Monetarily the person is never happy. He will lack intelligence and happiness from children. His Mercury dasa will deprive him benefic effects of even the other good yogas, Gemini ascendant : He will beget a chaste, good looking and obedient wife. However, Mercury dasa may portend danger either to self or spouse. Cancer ascendant : The native may be addicted to vices. (According to our observations, when the J2th lord occupies a fiery sign, the person resorts to smoking.) Their vices may be more towards asphere in which extra cleverness is involved, for example gambling. If Merevry is an excellent growth of prosperity in Mercury dasa. If otherwise connected, there will be adverse results. Leo ascendant : The native will be fortunate in respect of childern and means. Virgo ascendant : He will achieve an unobstructed growth in regard to profession and reach enviable heights, possibly as a religious teacher, exponent of Meditation andthe like.’ Material side of work includes teaching in educa tional institutions, mathemation etc. Libra ascendant: The natlve’s father will acquire good fortunes. One of the younger brothers may be a source of trouble to the native. Diseases of ## Page 337 Chapter 26 333 the calves or thinness of legs/feet etc. may result. Scorpio ascen- dant : Financially the native is always ata loss. Occasionally gains may be there to be only overpowered by losses. Mercury dasa coinciding with boyhood may be a killer while in the later part of life this dasa may create various kinds of obstacles in domestic life. Sagittarius ascendant : There will be overall hap- piness, wealth etc. Mercury in this ascendant will prove highly auspicious. If Jupiter or Saturn join him, the native will amass millions in modern value. Capricorn ascendant : Mercury alone in the 12th in Sagittarius will again prove quite beneficial. Thefather of the native may be in seperation from family. He seldom helps the native in his ad/ancement. Aquarius ascendant : It confersa long span of life to the elder brot her/sister of the native. The native may develop problems of hearing. He will be generally free from enemies if Mercury is related to Jupiter, Mars or Saturn, Pisces ascendant: Almost similar results as for Sagittarius ascendant will accrue. But richness cannot go that far. aa qed: avs: aeadne: garfequgta: | aTaTgaT Tat: vara fagrarfestaea ue 0 fagaraaeaaal ayfagadtadfeaarar a1 afaat waasafeal faces wet g8 gee: non 19-20. MERCURY IN CAPRICORN : If Mercury in Capricorn at birth, the native will be mean, dull, impotent, willdo others’ work, be devoid of virtues, be subjected to various kinds of miseries, will dream, wander etc. be a tale- bearer, be untruthful, devoid of relatives, dirty and timid. Notes : Mercury, who is himself an impotent planet, if be in Caprizorn (or Aquarius) owned by Saturn, another impo- tent planet the effects will only be adverse. The native cannot make any progressive achievements. See how the planet Mer- cury reacts from Capricorn according to various ascendants : Aries ascendant : The native will not be hippy in professi- on. He will frequently change the career part of life. Impotence to brother is denoted by this position. Taurus asdendant : This ## Page 338 334 Saravali is however a good position for Mercury to give anough monet- ary gains and Raja Yoga. The native'will not have progenic ability. Gemini ascendant : The native lacks in general and is devoid of maternal happiness in particular, He will not receive much education, If at all he acquires some landed property, it will only be uncultivable lands. Cancer ascendant: Should Mere- ury be in Capricorn for this ascendant, the native will see inim- ical disposition of the wife for a considerable part of life. The wife will be very extravagant. The subject may have slight defe- ct in legs. Leo ascendant : With Mercury in the 6th, the native will run through financially difficult periods for a major part of life. Virgo ascendant : The native with Mercury in Capricorn will obtain twins. He will occupy significant positions in fields like teaching writing, occult scienc s, etc. Libra ascendant : The native’s father may be fortunate while mother's longevity is affected adversely if Saturn is not strong. Alternatively, the mother may suffer form serious sickness. Scorpio ascendant : The native will have a long lease of life but lesser degree of ntelligence. Sagittarius ascendant: Mercury in Capricorn will give abundant wealth right from birth. Jupiter’s joining may weaken the goad effects in regard to wealth, Capricorn ascen- dant: The native will be very fortunate but may suffer from irrecoverable sickness. Aquarius ascendant: This position of Mercury will affect the longevity of the native and the scope of obtaining progeny as well. Pisces ascendant : Marriage will Prove a beneficial tie and the native will be brought up by his mother with extreme care and affection. : aqgfemiziga: statanta asifafgared: 1 azafegat a gfe: dtafagtaecatsara 0 320 afagearaqifiead az faaraafas afagdatsfavite: acta afeet fadara naan 21-22. MERCURY IN AQUARIUS : Should Mercury be in Aquarius at birth, the subject will be bereft of good disposi- tion and good deeds, be attached to many religions, will give up doing worthy things, be insulted by others, be impure, be ## Page 339 Chapter 26 335 not virtous, be very wicked, be inimical to wife, be devoid of carnal pleasures, be very unfortunate, very timid, impotent, dirty and modest. Notes : Mercury in Aquarius will give following results for different ascendants : Aries ascendant : The native willearn abundantly and through unfair means. He will have more sisters and become fortunate through them. Taurus ascendant : He will stand to make huge commercial gains. Gemini ascendant: He will enjoy great paternal bliss and legendary luck. Cancer ascen- dant : Only difficulties exist throughout. Leo ascendant : A very cunning wife is indicated by Mercury in Aquarius. How- ever, she will be a signpost for the native’s fortunes. Virgo ascendant : There will be adversities through litigations while diseases will trouble the person. Even other Rajayogas may become ineffective in Mercury dasa. Libra ascendant : The native will procure very obedient and favourable children. Mercury dasa will confer excellent results on him. Scorpio ascendant : Though there may be seeming obstructions in one’s learning, with Mercury in Aquarius, the native can become highly learned. Maternal bliss may lack to some extent if Saturn is not favourable. With the’ascendant lord Mars becoming unfavourable by weak shadbala etc, a dismal picture will be Painted by fate in respect of general happiness of the native. Sagittarius ascendant : If Mercury occupy Aquarius at birth, one will see very limited success in professional life. Capricorn ascendant : For this ascendant, Mercury in Aquarius will bestow all kinds of wealth. A great deal of paternal inheritance is indicated. Aquarius ascendant : Longevity is quite minimum with Mercury in Lagna. There willbe more obstacles in life than easiness. Pisces ascendant : Mercury in Aquarius does not prodvce any significantly good results but trials and tribulations. araratafaca @araciisastt « eftaea gagafa: efaarg: wat a guat faaata: 0 8g qearfendgaat faaraafanarfagesa qwaadaazal wma oafadsua: salwar en ## Page 340 336 Saravali 23-24. MERCURY IN FALL : Should Mercury be in Pisces, one will be fond of good conduct and purity, will live in foreign countries, be issueless, poor, will have a chaste wife, be virtuous, fortunate, be devoid of religion, be skilful in stitching etc., and be devoid of profane knowledge, aquaintance with sastras and fine arts, will be proficient in bagging other’s wealth and will be devoid of wealth. Notes : Mercury is in fall in Pisces and only in exceptional circumstances will he be ina position to bestow aus; results. For various ascendants, he produces undermentioned effects : Aries ascendant : The initial part of Mercury Dasa will prove highly ominous while the later part will be quite favour- able. Taurus ascendant : The position of Mercury in 11th will cause ear defects, misunderstandings with elder brothers or their early demise and unfortunate children will result. Gemini ascendant : The native will do unpleasant and illegal acts, will have obstructed professional prospects and will lack maternal bliss. Cancer ascendant : Always there is an element of ill-luck with Mercury in Pisces Father's affection will not be enjoyed by the native. Leo ascendant : The native’s survival will be in doubt right from the boyhood, i.e. indications of shortlife will be often produced by this position. Virgo ascendant : Marriage will be wrecked to pieces. This position will normally cause lasting separation/divorce etc. Libra ascendant : The native will be always a loser at the hands of his enemies and litigations. Scorpio ascendant: The subject will be quite dullwitted, will suffer from abdominal disorders and will give birth to dead children Ifa child were alive, it isa source of misery to him. Sagittarius ascendant: Mercury in Pisces will deprive the native of all kinds of general happi- ness and learning. The native will be an -absolute failure in the matter of profession and will suffer abject poverty. Capricorn ascendant : Posited in Pisces, Mercury will be a source of pecu- liar diseases and inimical co-born. A very unlucky person is thus born with Mercury in this sign while Capricorn ascerds. Aquarius ascendant: Monetarily, the native will bea wreck. ## Page 341 Chapter 26 337 Cut short life will be thrusted on the native. Pisces ascendant : The native will be himself a residence for vast miseries. Marital bliss, if at all marriage is consummated, will be a day-dream. waaad gered qifaacmrasad aga) Hwa gates aqut gad aAwAu Ww watata eet gafasantes fafa | afatannfanfad aaaet gaat au wh aqatia gard wagata a ofeed aah aaafe gor ese: sqrad fafaqaead 777 Wo UN afed sax afsa: frag te a Wafedsafa oo waaeaTATe TT Ne TEIN FAT MUATTGTA A_raraTy | weafas face: aah eidgd afte: eu wfaxge aftect frafecugetsiag-fad wate | sa feafaxd sao at feign 25-30. MERCURY IN ARIES/SCORPIO AND ASPE- CTED BY OTHERS: Should Mercury occupy a sign of Mars at birth and be aspected by the Sun, the person will be truthful, be very happy, be honoured by the king, and be patiently disposed. If the aspecting planet be the Moon, the native will steal the hearts of the fair sex, will serve others, be dirty and be berft of virtues. If Mars aspects Mercury as above, one will be a liar, a sweet speaker, will promote quarrels, be learned, affluent, dear to king and valorous. Should it be Jupiter that aspects Mercury as above, one will be happy, will possess a glossy and hairy physique, wiil have attractive hair, will be very rich, will command others and be sinful. If Venus aspects Mercury as above, the subject will be in royal service, be fortunate, principal among men or in his town, will speak skilfully, be trustowrthy and will be endowed with a wife. Saturn aspecting Mercury ina house of Mars denotes that the person will experience miseries, be fierce, be intent upon doing cruel activities, and be devoid of his own men. ## Page 342 "338 Saravali afwugeaad sarfiadg atiaarecaqs fanncese: dla: Hea oafsasd faaFa 2g ul seafad aaard gewftanttinet genera) ead atzafad maafdfaa: fart nan corfafacfefaded fered yorantraracay | saafa faaqeset afgcsd aafaatea: 1 33 ms qganad dageifuas eaaqs fazaqeeegiasaafa diva: faamgea: u ayn gai afd gfad acargieatfnd frat: gaat gadtat Get gale: deen ayn gayest: garg argetndfaay earfaaradagst atea: Hed at afer ag u 31-36 MERCURY IN TAURUS | LIBRA IN ASPECT TO OTHERS : Should Mercury be in a house of Venus and be aspected by the Sun, the subject will suffer from penury and accute grief, will have a sick physique, be interested in serving others and wili be censured. If the Moon aspects Mercury as above, the native will be trustworthy, affluent, firmly pious, devoid of sickness, will have lasting family ties, be famous, and bea king’s minister. Should Mars lend his aspect to Mercury as above, the native will be troubled by diseases and enemies, te distressed, will incur royal insult and will be deprived of all worldly objects. Jupiter aspecting Mercury as stated above indicates that the native will be highly learned, will fulfil his promise, will be leader of a country/city/group of men, and be famous. If Venus aspects Mercury as mentioned above, the person will be fortunate, soft in disposition, be happy, will enjoy good robes make up etc., and will steal the hearts of the fair sex. If Saturn throws his aspect on Mercury in a house of Venus, the subject will be devoid of happiness, be dirty, will experience many dlscases and evils, will be subjected to grief on account of his relatives and be distressed. ## Page 343 Chapter 26 339 afaaawad gui qraeanateat afadey | afad witfe as efamr eet gu: waZFu won gagrafaara wag wesaad qeeq | waafe afaar get ga: gy ademgnecu fasama afed sfargad atyed a) asramata GEA cage vfate ween zen afaaafauad sfaeagarefavagfeareg | qqeasa eset wane qt eae atau voll ma aaa gi ar afaqaa afer) wage fata eet waafe atarmarayy uve aadtfaa fait ana ofeegzagaq atea: cage gel vfada at war FeTu¥Q 37-42. MERCURY IN OWN HOUSE AND IN ASPECT TO OTHERS : Should Mercury be in Gemini/Virgo and be aspected by the Sun, the native will speak truth, be fortunate, dear to king, bea lord himself, be polite in his activities and be liked by all. Should the planet Mercury be in his own house and recive the aspect of the Moon, the person will be sweet in disposition, garrulous, will promote quarrels, be intrested in acquiring sastraic knowledge, firm and will succeed in all his undertakings. If the aspect is from Mars, the person will have an ijnured body, be dirty, be a genius, will serve the king and be dear to him. If Jupiter be the aspecting planet, one will be a king’s minister, be excellent, be beautiful, charitable, rich, be endowed with bis own men and be courageous. If Venus lends his aspect to Mercury as above, the native will be highiy learned be a royal employee, be a, messenger, will honour friendship and will be interested in base women. If Saturn aspects Mercury as above, one will be progressive-minded, be ‘modest, will achieve success in undertakings started by him, and will be wealthy with money and clothes. ## Page 344 340 Saravali Tae raRTe agategH ara afer” | wana cfaar geet get ag frfreattes ma: 1 ¥R gafafaariaaart gafefafadt @ z:faandtieqs wees afaaedl anf qeafad dane u vacaqanfageat fra sericea ateq! aafaa: afagg qea dha: feararyn vy Rerfeanfaafed aeagd aca aReaTUTy | qeam gee: afd fawrai cred ga: wae nu vgn qadagned = fadad itaaranfafar) gai afd afd wed gafaa: atau vou aeueia gawd aman gufaqad at gel agate: wea alte: aft ven 43-48. MERCURY IN CANCER IN ASPECT TO OTHERS : Should Mercury be in Cancer, in aspect to the Sun, one will be a dhoby, or a gardener or a house-builder or gemsmith. If the Moon aspects Mercury as above, one will be deprived of wealth (or energy of the physique) on account of women and will be miserable for the same reason. If Mars lends his aspect to Mercury in Cancer, he will not have much learning, be garrulous, be a great liar, will produce fictitious things, be a thief and will be affectionate in speech. If Jupiter aspects Mercury as above, one will be a great scholar, very dear (to all), be fortunate, dear to the king and will cross the boundaries of learning. Should Venus aspect Mercury as above one will be equal to Cupid in appearance, will possess attractive physicque, be weil-versed in the art of singing and in playing musical instruments, be fortunateand softly disposed. If Saturn aspects Mercury as above, one will be fond of vanity, be sinful, will face imprisonment, be devoid of virtues and will hate coborn and elders. aed fermegedt aaqmag at ga: Teh fat ad fet asanard fananorgn ven weufaanfaagt steamattaqaciafaay t ## Page 345 Chapter 26 341 afd qaiteae = gua aeafera: atea: yo ul Mata vfauat gard fararqaredqs magettamrd ates | dtnargea: ye tl agarafasa tad aniteat cafreraq | afearcargaga sea ogedifaa: ater 1 xR afaraed fad friad argareanfadited | wmafa fata acct afar oad fag xan eat ea afted | ada a afeg.fad cfang santa qaatad cfangee: 1 xx 1 49-54. MERCURY IN LEO IN ASPECT TO OTHERS: If Mercuy occupies Leo at birth and is aspected by the Sun, the native will be jealous, rich, virtuous, cruel, mean, fickle- minded and shameless. If the Moon aspects Mercury as above, one will be very beautiful, very skilful, be interested in poetry, fine arts, music and dance, be wealthy, and virtuous. If Mars lends his aspect to Mercury as above, one will be base, miserable, physically injured, unskilful and impotent. If Jupiter aspects Mercury as above, one will be beautiful, very learned, be a gifted speaker, be very famous, and be endowed with attendants and conveyances. If Venus be the aspecting planet, one will possess unparallel beauty, be softly disposed, will have an attractive face, will have many conveyances, be very courageous and be a minister. If Saturn aspects Mercury as above, one will be tall in stature, be splendourless, be ugly, will emanate bad smell from body out of sweat and be miserable. Yeo aRadifeanendiaganrgt? = treaq safe vfaar’ eet sage axe: geeq 1 xy Rewnfeguant seafad ard yoyera: | gaurfrrmared Gea aeafera: atea: uve aaigiearcrant aati fefararfaai ate Bua fafaerafad ated geafet ear: n you ## Page 346 342 Saravali eqfaafaqrarcd ged sfreordfaaray t quran fatinciig ated TEU xen SUTRUET Reaad aatfiad wets qed qygages: qgart atddgad ofa: nye n gaizomfacd aged gtesiinafeafaay wea cfagagsal gat at adarifasceq i gon 55-60 MERCURY IN JUPITER'S HOUSE IN ASPECT TO OTHERS: Should Mercury be in Sagittarius/Pisces, and aspected by the Sun, one will suffer from urinary diseases and epilepsy, and be peaceful in disposition. Ifthe Moon aspects Mercury as above, he will be a writer, be beautiful par excellence, be very affluent, trustworthy, amiable and happy .If Mars aspects Mercury as above, he will be a leader of townsmen or thieves, will reside in forests, and will be a famous writer. Should Jupiter aspect Mercury as above, he will be rich by memory, intelligence and descendency, be beau- tiful, noble and knowledgeable, be aking minsiter, or his trearurer and be a writer. If Venus be the as pecting planet, he will educate boys and girls, be wealthy, soft in disposition and brave. If Saturn aspects Mercury as above, he will be intent upon living in forests, will eat much, be wicked dirty and will be unsuccessful in all his undertakings. aeanfaaregad aguet frst frateray | waafe tag ge: dears aaa: emaq ugg ul wasted oaag gsagereraafins at! wreereqnat afd arafiva: «Hea n are araafagated alerraarat Garay | Hal ygaret vfaaraig ge: geez uegu ageraraads aageafagind gfarq wed get qe: ahkeyg aaa: earaqn ex nu Marcia faed gfefagit a ama at afaganad wet aniaasel ga: afd ney ## Page 347 Chapter 26 343 ait gefed wdet anfagfedt aq ea afaar gee: dteng ater: garg gg ul 61-66 MFRCURY IN SATURN’S HOUSE IN ASPECT TO OTHERS: If Mercury be in a house of Saturn and is as- pected by the Sun, one will be 2, boxer, be very strong, one will cat abundantly, be censured, will speak sweetly and be famous. If the Moon aspects Mercury as above, he will derive his livelihood through water, be plentiful, will sell flowers, liquor and bulbs (vegetables), will have fierce appearance and be firm (i. e. not moving much). If Mars aspects Mercury as above, one will be infirm in speech, be calm in disposition, bashful and happy. If Jupiter aspects Mercury as stated above, he will be endowed with abundant money and grains, be honoured in his village/town and by his men, be happy and be famous. If Venus aspect Mercury as above, he will be the husband of a base women, be ugly, be unintelligible, be troubled by sexual passion and will have many sons. If Saturn aspects Mercury as above, he will be sinful, very poor, miserable and mean. fe weormadfafrarat araaeat gearet are ugfaaisera: 1 2q U1 ‘Thus ends the 26th chapter, entitled ‘Effects of Mercury in Kalyana Varma’s Saravali. In the second Volume of SARAVALI (Glimpses) The second and last volume of Saravali consists of chapters from 27 through 55, with original verses and English translation and commentary. Important among them are: Effects of Jupiter, Venus and Saturn in various signs; special effects given by them when aspected by others; Bhava effects ; ‘Two planets giving special results when joining in angles, 9th house, 10th house (both these houses have been additionally and elaborately discussed); Raja Yogas, Planetary Rays; Marring of Yogas} Moola Dasa; Longevity; Evils in Dasas and antidotes thereof; Female Horoscopy; Death; Decanates; Navamsas; Lost Horoscopy; Ashtaka Varga etc. ## Page 348 Page No. Line No. For 18 21 22 24 28 29 37 43 51 63 63 3 86 136 205 207 207 213 217 229 257 324 325 326 18 15 25 24 26 S 12 23 13 13 28 5) 31 28 23 19 2 16 1 30 25 27 8 33 zodiac ara welt aay Aries as 4th bile...blood ghatis to us. Some Nau Chatra Pakshi Yupa Srinagtaka Varsha fixed in the first residens in by the Moon zodiacal sign il gare st guts 18 degrees quadruped. mage ang guid Lagna as 1/4th blood is enraged by bile ghatis from to us when some Nau, Chatra Pakshi, Yupa Sringataka Varaha dual in the first or resides or if helped by the Moon ## Page 350 PLEASE DO NOT REMOVE CARDS OR SLIPS FROM THIS POCKET UNIVERSITY OF TORONTO LIBRARY